Glyma04g12555 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g12555

Feature Type:	gene_model
Chromosome:	Gm04
Start:	11709498
stop:	11711839
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g12555

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PTHR10992	Panther	ALPHA/BETA HYDROLASE RELATED	JGI		ISS
PTHR10992:SF279	Panther	EPOXIDE HYDROLASE-RELATED	JGI		ISS
UniRef100_B4UW64	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Epoxide hydrolase (Fragment) n=1 Tax=Arachis hypogaea RepID=B4UW64_ARAHY	SoyBase	E_val: 2.00E-26	ISS
UniRef100_I1LS33	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LS33_SOYBN	SoyBase	E_val: 3.00E-51	ISS

Expression Patterns of Glyma04g12555

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g12555 not represented in the dataset	Glyma04g12555 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g12555 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g113100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g12555

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g12555

Limit To All Plant Sequences

>Glyma04g12555.1   sequence type=CDS   gene model=Glyma04g12555   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGCTGCAGCAAATGCTGGCTACCGGGCTATTGCCTTTGATTTTAGAGGTTATGGACTTTCTGAGCATCCCGCGGAGCCACAAAAAGCAAACTTACTTGACCTTGTTGATGATGTCGTGGGTCCGTTGGATTCATTAAGCATTACCAAGGAGGCTGGGAGGGCAGAAGCAGATTTTGTTCGCTTTGATGTTAAGTCAGTTATAAGGAACATCTACACATTCTTCTCTAGAAGTGAGATACCAATAATAGGTGATAATCAGGAAATCATGGATTTGTATGACCCAACTACTGCCCTGCCACTAGGGTTCTCTGAGGAAGACCTGGCAACCTATGCATCACTATTCAAAAAATCTGGGTTCTAA

Predicted protein sequences of Glyma04g12555

Limit To All Plant Sequences

>Glyma04g12555.1   sequence type=predicted peptide   gene model=Glyma04g12555   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIAAANAGYRAIAFDFRGYGLSEHPAEPQKANLLDLVDDVVGPLDSLSITKEAGRAEADFVRFDVKSVIRNIYTFFSRSEIPIIGDNQEIMDLYDPTTALPLGFSEEDLATYASLFKKSGF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain