SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g12510

Feature Type:gene_model
Chromosome:Gm04
Start:11600619
stop:11601985
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g12510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G55670AT Annotation by Michelle Graham. TAIR10: photosystem I subunit G | chr1:20802874-20803356 REVERSE LENGTH=160 SoyBaseE_val: 6.00E-71ISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009780GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic NADP+ reduction SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0042550GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem I stabilization SoyBaseN/AISS
GO:0050821GO-bp Annotation by Michelle Graham. GO Biological Process: protein stabilization SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009522GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem I SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030093GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast photosystem I SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01241PFAM Photosystem I psaG / psaK JGI ISS
UniRef100_B9T0J8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem I reaction center subunit V, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9T0J8_RICCO SoyBaseE_val: 3.00E-72ISS
UniRef100_I1JVN0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JVN0_SOYBN SoyBaseE_val: 1.00E-115ISS

Expression Patterns of Glyma04g12510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g12510
ParalogEvidenceComments
Glyma06g48030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g12510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g112800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g12510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g12510
>Glyma04g12510.1   sequence type=CDS   gene model=Glyma04g12510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCAGCCTCAGCCTCATCCATGATATCAACACCAGCCTTATCTCCAACCATCCAAAAGCACCATCATTTGAAGCCATCCAACGTGTGCTTCCAAGGTCTTAGACCCCTCGCAAGGTTCACCAAAGCCTCATCAACCAAAGTGAGCACCACCACCAAAAGGGTTATTCCAAAGGGTGGTGTTAGAGCTGAACTCAACTCAGCCCTTGTGATAAGCCTCAGCACTGGCCTCTCCCTCTTCTTGGGAAGGTTTGTGTTCTTCAACTTCCAAAGGGAGAACGTGGCAAAGCAAGTGCCTGAGCAGAACGGCCTCACACACTTTGAGGCTGGTGATACACGTGCCAAGGAGTATGTCAGCCTCCTCAAATCCAATGACCCTGTTGGATTCAACATTGTTGATGTCTTGGCTTGGGGCTCCATTGGCCATGTTGTTGCTTACTACATCTTGGCCACCACTAGCAATGGCTATGACCCTGCATTCTTTGGCTGA
Predicted protein sequences of Glyma04g12510
>Glyma04g12510.1   sequence type=predicted peptide   gene model=Glyma04g12510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAASASSMISTPALSPTIQKHHHLKPSNVCFQGLRPLARFTKASSTKVSTTTKRVIPKGGVRAELNSALVISLSTGLSLFLGRFVFFNFQRENVAKQVPEQNGLTHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHVVAYYILATTSNGYDPAFFG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo