SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g12170

Feature Type:gene_model
Chromosome:Gm04
Start:11147217
stop:11151770
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g12170
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G10140AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF2062 (InterPro:IPR018639); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G33490.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukary SoyBaseE_val: 6.00E-85ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0015824GO-bp Annotation by Michelle Graham. GO Biological Process: proline transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B7F978UniRef Annotation by Michelle Graham. Most informative UniRef hit: cDNA, clone: J075115L08, full insert sequence n=1 Tax=Oryza sativa Japonica Group RepID=B7F978_ORYSJ SoyBaseE_val: 1.00E-76ISS
UniRef100_I1JVK4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVK4_SOYBN SoyBaseE_val: 3.00E-126ISS

Expression Patterns of Glyma04g12170
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g12170
ParalogEvidenceComments
Glyma06g48220 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g12170 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g110500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g12170
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g12170
>Glyma04g12170.2   sequence type=CDS   gene model=Glyma04g12170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAAATGGGAATGTGAAAATAACCAGTTGGGTCCAAAAGAAGATCACTGATCCCCTTCTCTCCATTATCCGAAGAGGAACTGAACCAAACCAGTTGGCTTTCTCTGCTGCTCTTGGTATTACATTGGGACTATTTCCTATATGTGGTGTCACTGTGTTCCTCTGCGGAATGGCTATTGCATTGCTTGGATCATTTTGCCATGCTCCAACTGTGATGCTTGCAAACTTTATTGCTACTCCCATAGAGTTGAGTCTGGTTGTACCCTTTCTACGCCTTGGTGAGGTTATCTCTGGTGGATCTCATTTCCCTTTAACATCTGATGCTTTAAAGAAAGTTCTTACTGGCCAAGCTTCACGTGAAGTCTTATTAAGTGTGGCCCATGCGTTATTAGGGTGGCTGGTTGCATCACCATTTATTTTGGGAACTCTATACATAGTTCTTTTACCATGCTTCAAAATTTTAGTTCATAATTTCTCAAGTGTTCCTTTAAGTCCAAAGAAGCCGCTCAATCCACACTCAGAAGTAAAGCTGAAGGTAAGGGATGTTTGA
Predicted protein sequences of Glyma04g12170
>Glyma04g12170.2   sequence type=predicted peptide   gene model=Glyma04g12170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVNGNVKITSWVQKKITDPLLSIIRRGTEPNQLAFSAALGITLGLFPICGVTVFLCGMAIALLGSFCHAPTVMLANFIATPIELSLVVPFLRLGEVISGGSHFPLTSDALKKVLTGQASREVLLSVAHALLGWLVASPFILGTLYIVLLPCFKILVHNFSSVPLSPKKPLNPHSEVKLKVRDV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo