SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g12130

Feature Type:gene_model
Chromosome:Gm04
Start:11117997
stop:11119316
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09640AT Annotation by Michelle Graham. TAIR10: ascorbate peroxidase 2 | chr3:2956301-2958163 FORWARD LENGTH=251 SoyBaseE_val: 9.00E-23ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004601GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxidase activity SoyBaseN/AISS
GO:0016688GO-mf Annotation by Michelle Graham. GO Molecular Function: L-ascorbate peroxidase activity SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PF00141PFAM Peroxidase JGI ISS
UniRef100_I1JVK0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JVK0_SOYBN SoyBaseE_val: 3.00E-114ISS
UniRef100_Q43758UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ascorbate peroxidase n=1 Tax=Glycine max RepID=Q43758_SOYBN SoyBaseE_val: 7.00E-27ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g12130.1   sequence type=CDS   gene model=Glyma04g12130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGCTTCATCGCTGAGAAGAGATGCGCTCCTCTAATGCTCTATGGCACTCTGCTGGAACCTTTGACAAGGGCACAAAGACTAGTGGACCCTTCGGACATTGCTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTATGCCGATTTCTACCCGTTGGCTGGCGTTGTTGTCGTTGAGGTCACGGATGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGCAATAATGGTTGTTATGACTACCATTAAGAGTATATTGTTGTCACTGTTATTTTTTTTGTTTGTTATTTTCATGCAATTCAGGTGGAAATGGAACTTACCAAATAGTTTGGTCAGAAACAAATTAAGTATGTCTTGCGAGATGTGGAAAGAGTTGCAGATTAAGGTGGCTGAATTACCTAAGGCCAAACCTCAAAAGAGGAAACTACACCAAGGAAGAGGAGGAAACTATTATCAAGCTGCACCGACATCT

>Glyma04g12130.1   sequence type=predicted peptide   gene model=Glyma04g12130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GFIAEKRCAPLMLYGTLLEPLTRAQRLVDPSDIAIRLLEPLKAEFPILSYADFYPLAGVVVVEVTDGPEVPFHPGREAIMVVMTTIKSILLSLLFFLFVIFMQFRWKWNLPNSLVRNKLSMSCEMWKELQIKVAELPKAKPQKRKLHQGRGGNYYQAAPTS







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo