Glyma04g12130 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g12130

Feature Type:	gene_model
Chromosome:	Gm04
Start:	11117997
stop:	11119316
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g12130

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G09640	AT	Annotation by Michelle Graham. TAIR10: ascorbate peroxidase 2 \| chr3:2956301-2958163 FORWARD LENGTH=251	SoyBase	E_val: 9.00E-23	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004601	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peroxidase activity	SoyBase	N/A	ISS
GO:0016688	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-ascorbate peroxidase activity	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PF00141	PFAM	Peroxidase	JGI		ISS
UniRef100_I1JVK0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JVK0_SOYBN	SoyBase	E_val: 3.00E-114	ISS
UniRef100_Q43758	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ascorbate peroxidase n=1 Tax=Glycine max RepID=Q43758_SOYBN	SoyBase	E_val: 7.00E-27	ISS

Expression Patterns of Glyma04g12130

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g12130 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g12130

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g12130

Limit To All Plant Sequences

>Glyma04g12130.1   sequence type=CDS   gene model=Glyma04g12130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGCTTCATCGCTGAGAAGAGATGCGCTCCTCTAATGCTCTATGGCACTCTGCTGGAACCTTTGACAAGGGCACAAAGACTAGTGGACCCTTCGGACATTGCTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTATGCCGATTTCTACCCGTTGGCTGGCGTTGTTGTCGTTGAGGTCACGGATGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGCAATAATGGTTGTTATGACTACCATTAAGAGTATATTGTTGTCACTGTTATTTTTTTTGTTTGTTATTTTCATGCAATTCAGGTGGAAATGGAACTTACCAAATAGTTTGGTCAGAAACAAATTAAGTATGTCTTGCGAGATGTGGAAAGAGTTGCAGATTAAGGTGGCTGAATTACCTAAGGCCAAACCTCAAAAGAGGAAACTACACCAAGGAAGAGGAGGAAACTATTATCAAGCTGCACCGACATCT

Predicted protein sequences of Glyma04g12130

Limit To All Plant Sequences

>Glyma04g12130.1   sequence type=predicted peptide   gene model=Glyma04g12130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GFIAEKRCAPLMLYGTLLEPLTRAQRLVDPSDIAIRLLEPLKAEFPILSYADFYPLAGVVVVEVTDGPEVPFHPGREAIMVVMTTIKSILLSLLFFLFVIFMQFRWKWNLPNSLVRNKLSMSCEMWKELQIKVAELPKAKPQKRKLHQGRGGNYYQAAPTS

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain