Report for Sequence Feature Glyma04g11991
Feature Type: gene_model
Chromosome: Gm04
Start: 10979125
stop: 10981036
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g11991
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G66870 AT
Annotation by Michelle Graham. TAIR10: ASYMMETRIC LEAVES 2-like 1 | chr5:26706621-26707562 FORWARD LENGTH=313
SoyBase E_val: 1.00E-66 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009954 GO-bp
Annotation by Michelle Graham. GO Biological Process: proximal/distal pattern formation
SoyBase N/A ISS
GO:0009965 GO-bp
Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis
SoyBase N/A ISS
GO:0048441 GO-bp
Annotation by Michelle Graham. GO Biological Process: petal development
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
PF03195 PFAM
Protein of unknown function DUF260
JGI ISS
UniRef100_G7K830 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein n=1 Tax=Medicago truncatula RepID=G7K830_MEDTR
SoyBase E_val: 8.00E-67 ISS
UniRef100_I1JVJ1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JVJ1_SOYBN
SoyBase E_val: 1.00E-86 ISS
Expression Patterns of Glyma04g11991
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g11991
Paralog Evidence Comments
Glyma06g11181 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g11991 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g106400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g11991
Coding sequences of Glyma04g11991
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g11991.1 sequence type=CDS gene model=Glyma04g11991 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCGTCGTCGAATTCGCCGTGTGCGGCGTGCAAGATTCAGCGTCGGAAGTGCACGCAGGAGTGTGTTTTCGCGCCGTATTTTCCGCCGGACAATCCGCAGCGGTTCGCGTACGTGCACAAGGTGTTCGGGGCGAGCAACGTGGCCAAGCTACTCAACGAGCTTAACGCGGCGCAGCGCGAAGACGCGATTAAGTCCTTAGCATACGAGGCAGAAGCGCGTTTGCGGGACCCGGTGTATGGCTGCGTGGGTCTGATCTCCATCCTCCAGCACAGACTCAAACAGCTGCAGAGCGAACTCCACCGCGCCAAAAAGGAACTCGCTTCCTACGTCGGACCCCAGGCCATGCTTCCTCCTCCGCCTCCTCCCCCTCTGCTGCCACCACAGTCACCCCGCACTTTCTCGCTTTTCCCTTTCAAAACCGCACCCACCAATCAGCAGGATCTTTTCGGCTTCCACGACGATGGCGGTGCTTCGGCTTCCCACGGTGTATTGAACCACCACCTCGCCTTATTCTCGCCTTCCCCCGCAGTTGATCACGCGTTTTCTCACCCGCCGATGCACTCTCTTGCACTTCCGCATCACTCACACCTTACGCGTTCCCCTATGCAACCCAGGCACCAAACTGATCCGGCTTAG
Predicted protein sequences of Glyma04g11991
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g11991.1 sequence type=predicted peptide gene model=Glyma04g11991 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSSSNSPCAACKIQRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQREDAIKSLAYEAEARLRDPVYGCVGLISILQHRLKQLQSELHRAKKELASYVGPQAMLPPPPPPPLLPPQSPRTFSLFPFKTAPTNQQDLFGFHDDGGASASHGVLNHHLALFSPSPAVDHAFSHPPMHSLALPHHSHLTRSPMQPRHQTDPA*