SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g11941

Feature Type:gene_model
Chromosome:Gm04
Start:10956412
stop:10961824
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73720AT Annotation by Michelle Graham. TAIR10: transducin family protein / WD-40 repeat family protein | chr1:27725059-27729722 FORWARD LENGTH=511 SoyBaseE_val: 2.00E-52ISS
GO:0008380GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
PTHR22848Panther WD40 REPEAT PROTEIN JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_B9RE42UniRef Annotation by Michelle Graham. Most informative UniRef hit: WD-repeat protein, putative n=1 Tax=Ricinus communis RepID=B9RE42_RICCO SoyBaseE_val: 1.00E-55ISS
UniRef100_UPI0002339AC5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339AC5 related cluster n=1 Tax=unknown RepID=UPI0002339AC5 SoyBaseE_val: 4.00E-82ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g11941 not represented in the dataset

Glyma04g11941 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g106300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g11941.1   sequence type=CDS   gene model=Glyma04g11941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATCCCCTTCTTCTCTTCGCATTTTTCTCAATCCTGCGGACTATGACTTGGGTGTGGGATTACATAAGTGGAAAGCTGAAGAAAGATCTACAGTACCAGGCTGATGAAGTGTTCATGATGCATGATGATGTTGTGCTTTGTGTAGACTTTAGCACAGATTCAGAAATGCTTTCATCTGGGTCTCAAGATGGAAAGATTAAAGTTTGGCGTATTAGGACTGGTCAGTGCTTACAGCGTCTTGAACGTGTTCATTCTCAAGGTGTCACAAGTGTTTCCTTCTCCCGTGATGGAAGCCAGTTATTAATCACTTCATTTGATAGCACAGCAAGAATTCATGGCCTCAAATCTGGAAACTGTTAA

>Glyma04g11941.1   sequence type=predicted peptide   gene model=Glyma04g11941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHPLLLFAFFSILRTMTWVWDYISGKLKKDLQYQADEVFMMHDDVVLCVDFSTDSEMLSSGSQDGKIKVWRIRTGQCLQRLERVHSQGVTSVSFSRDGSQLLITSFDSTARIHGLKSGNC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo