Glyma04g11890 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g11890

Feature Type:	gene_model
Chromosome:	Gm04
Start:	10631909
stop:	10633194
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g11890

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_G7L4F2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GTP cyclohydrolase I n=1 Tax=Medicago truncatula RepID=G7L4F2_MEDTR	SoyBase	E_val: 5.00E-19	ISS
UniRef100_I1JVI8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVI8_SOYBN	SoyBase	E_val: 3.00E-88	ISS

Expression Patterns of Glyma04g11890

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g11890 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g11890

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g11890

Limit To All Plant Sequences

>Glyma04g11890.1   sequence type=CDS   gene model=Glyma04g11890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAATGTGCCAAGTACTGATGCTAGATGCATTTTCTATGTGTCTCTTGAGCTCACTTTTTGCACTTCTTCTTTCTCCCTGCTATTGTTACAGACAAAAGGTGAAGGACATTGTTCAAGGTGCTTTATTCCCTGAAGCTGGTCTAGATAATAGAGTTGGTCATGCTGGGGGAGTAGGTGGACTCGTGATTGTTCGAGATCTTGACTTGTTATCCTATTACGGTGGAGCACCGTCTTTGAATCCAACGTCGTCGAAAGTTTATGACGGTCCTATAAAACCCGTCTTAGAAAAACATTATCTTCTAAGACGGTCCATGAAAAAATGCTCAAATATTGACATTAATAGCAGGCTTGCACCTCACACTGTGATTGAAAATAACAAATAA

Predicted protein sequences of Glyma04g11890

Limit To All Plant Sequences

>Glyma04g11890.1   sequence type=predicted peptide   gene model=Glyma04g11890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTMCQVLMLDAFSMCLLSSLFALLLSPCYCYRQKVKDIVQGALFPEAGLDNRVGHAGGVGGLVIVRDLDLLSYYGGAPSLNPTSSKVYDGPIKPVLEKHYLLRRSMKKCSNIDINSRLAPHTVIENNK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain