|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G51040 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF339 (InterPro:IPR005631); Has 532 Blast hits to 532 proteins in 207 species: Archae - 0; Bacteria - 285; Metazoa - 16; Fungi - 41; Plants - 40; Viruses - 0; Other Eukaryotes - 150 (source: NCBI BLink). | chr5:20750700-20751790 FORWARD LENGTH=188 | SoyBase | E_val: 1.00E-17 | ISS |
| GO:0009062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process | SoyBase | N/A | ISS |
| GO:0080022 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary root development | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0008177 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: succinate dehydrogenase (ubiquinone) activity | SoyBase | N/A | ISS |
| PTHR12469 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR12469:SF1 | Panther | gb def: hypothetical orf, yol071wp [saccharomyces cerevisiae] | JGI | ISS | |
| PF03937 | PFAM | Protein of unknown function (DUF339) | JGI | ISS | |
| UniRef100_G7J2S2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Succinate dehydrogenase assembly factor n=1 Tax=Medicago truncatula RepID=G7J2S2_MEDTR | SoyBase | E_val: 5.00E-28 | ISS |
| UniRef100_I1JXS4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JXS4_SOYBN | SoyBase | E_val: 4.00E-49 | ISS |
|
Glyma04g11776 not represented in the dataset |
Glyma04g11776 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g105700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g11776.1 sequence type=CDS gene model=Glyma04g11776 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGAGTTTCAGAAATGCTGCAATCAATGTCTTCAGAGTGATCAATTCCAAAAAAGCCACCATCACTGCTTTCACAAACCCCCTTCACACTCTCAGGTTTACCCCTTTCTCGTCCCACACTCAAAATCAAGCCCTGGAAATCGATTTATCTAACGAAGAAAGCAAAAGACATTTGTTTAACCAGCTATTATATAGAAGCAAACAACGAGGGTTCCTGGAACTGGATTTGGTCCTCGGAAAATGGGTTGAGGCCGGACAACATTCACTCCTTGGATGA
>Glyma04g11776.1 sequence type=predicted peptide gene model=Glyma04g11776 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASFRNAAINVFRVINSKKATITAFTNPLHTLRFTPFSSHTQNQALEIDLSNEESKRHLFNQLLYRSKQRGFLELDLVLGKWVEAGQHSLLG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||