SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g11540

Feature Type:gene_model
Chromosome:Gm04
Start:9938585
stop:9939200
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g11540
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G62360AT Annotation by Michelle Graham. TAIR10: Carbohydrate-binding-like fold | chr3:23073020-23080455 REVERSE LENGTH=1227 SoyBaseE_val: 4.00E-61ISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
PTHR23303Panther CARBOXYPEPTIDASE REGULATORY REGION-CONTAINING JGI ISS
UniRef100_G7KTM5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nodal modulator n=1 Tax=Medicago truncatula RepID=G7KTM5_MEDTR SoyBaseE_val: 2.00E-85ISS
UniRef100_UPI000233A23BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A23B related cluster n=1 Tax=unknown RepID=UPI000233A23B SoyBaseE_val: 1.00E-99ISS

Expression Patterns of Glyma04g11540
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g11540 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g11540
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g11540
>Glyma04g11540.1   sequence type=CDS   gene model=Glyma04g11540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTGACTGATGATAATTGTCAAGTTTATATTCCTACATTTTCTTGTCAACTGGGTGTATATATTGAAGGATCAGTTTCACCTCCTCTTTCTGGCGTCCATATCAGAGTTTTTGCTGCTGGAGATAGCAACATTACTACACTTAAAAGTGGTGAATTGGTTCTTGAAACGACCACTGGTATTGATGGTTCCTTTGTGGCAGGTCCTTTGTACGATGATATTGGTTACAATGTTGAGGCTTCAAAGTCTGGATATCATTTAAAACAAGTTGCGCCTCATTCTTTTACTTGTCAGAAGCTTAGTCAAATTTCAGTACACATACATCACAAAGATGATTCTAAAGAGCCCATTCCTTCTGTTCTGTTGTCTTTGAGTGGTGACAATGGTTATAGAAACAACTCAGTATCAGGAGCTGGTAGGACATTCCTGTTTGACAATTTGTTTCCTGGAATGTTTTATTTGCGTCCT
Predicted protein sequences of Glyma04g11540
>Glyma04g11540.1   sequence type=predicted peptide   gene model=Glyma04g11540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LTDDNCQVYIPTFSCQLGVYIEGSVSPPLSGVHIRVFAAGDSNITTLKSGELVLETTTGIDGSFVAGPLYDDIGYNVEASKSGYHLKQVAPHSFTCQKLSQISVHIHHKDDSKEPIPSVLLSLSGDNGYRNNSVSGAGRTFLFDNLFPGMFYLRP






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo