Glyma04g11420 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g11420

Feature Type:	gene_model
Chromosome:	Gm04
Start:	9842676
stop:	9845151
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g11420

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16565	AT	Annotation by Michelle Graham. TAIR10: alanine-tRNA ligases;nucleic acid binding;ligases, forming aminoacyl-tRNA and related compounds;nucleotide binding;ATP binding \| chr3:5640531-5642675 REVERSE LENGTH=256	SoyBase	E_val: 2.00E-23	ISS
GO:0006419	GO-bp	Annotation by Michelle Graham. GO Biological Process: alanyl-tRNA aminoacylation	SoyBase	N/A	ISS
GO:0043039	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0004813	GO-mf	Annotation by Michelle Graham. GO Molecular Function: alanine-tRNA ligase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
PTHR11777	Panther	ALANYL-TRNA SYNTHETASE	JGI		ISS
PTHR11777:SF2	Panther	ALANYL-TRNA SYNTHETASE	JGI		ISS
UniRef100_G7JLH0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Alanyl-tRNA synthetase n=1 Tax=Medicago truncatula RepID=G7JLH0_MEDTR	SoyBase	E_val: 1.00E-24	ISS
UniRef100_I1JVH3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVH3_SOYBN	SoyBase	E_val: 4.00E-149	ISS

Expression Patterns of Glyma04g11420

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g11420 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g11420

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g11420

Limit To All Plant Sequences

>Glyma04g11420.1   sequence type=CDS   gene model=Glyma04g11420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAAGTTCCACTTTTTCATCCTTCGCTTCTCTCCTTCCATTGCGCTTCTCGCCTCGATGTCACACCTTCAAGCTTTTTTGTTGACCTTCTTCTTCCACCGTCGCACACTCTTCACCTCTTCTCTCCGGTGACCTGGACCGCTACCTCCGCTGCTCCATGCCACAGAACTCGTCGCCCCAACTCGCGGTTCTTGTCAGCGGAGGCGTCGATAGCAGCGTCGCTCGCCAGCTGCTCCACGCCGCCGGCCACTCCTACACCGCTTTCTACCTCAAGATATGGTTCCAACAACAAATTTCTAGTTTCTCATGTGGGAAATTTGAGCCTACACTCGAGAAAAGGGAAGGAGGTTTCACTGTTTGTTGATGAGTTCAGACGAAAACTGAACTCCAGATTGCATTCAGCAGGGCATTTGCTTGATATTTTTTTGCCAAGAATAAGATTGGGAAATTTAGAGCCTGGCAAAGCCTACCATTTTCCTGATGATTTGCTCCGTACTTGCTATTGTATTGTAACTATTGTTTCCTGGCCTTGGATTGAATATAAAGGTACAATTTCACAAAATGAAATGCAGAGTGCCTTCCAGTGTTTGTACAGAACTTTTTTATTTTATTTTGGATAA

Predicted protein sequences of Glyma04g11420

Limit To All Plant Sequences

>Glyma04g11420.1   sequence type=predicted peptide   gene model=Glyma04g11420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEVPLFHPSLLSFHCASRLDVTPSSFFVDLLLPPSHTLHLFSPVTWTATSAAPCHRTRRPNSRFLSAEASIAASLASCSTPPATPTPLSTSRYGSNNKFLVSHVGNLSLHSRKGKEVSLFVDEFRRKLNSRLHSAGHLLDIFLPRIRLGNLEPGKAYHFPDDLLRTCYCIVTIVSWPWIEYKGTISQNEMQSAFQCLYRTFLFYFG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain