Glyma04g11400 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g11400

Feature Type:	gene_model
Chromosome:	Gm04
Start:	9828691
stop:	9830620
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g11400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G08685	AT	Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein \| chr4:5550563-5551259 FORWARD LENGTH=159	SoyBase	E_val: 2.00E-63	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0042546	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF01190	PFAM	Pollen proteins Ole e I like	JGI		ISS
UniRef100_B7FN25	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pollen allergen Phl p n=1 Tax=Medicago truncatula RepID=B7FN25_MEDTR	SoyBase	E_val: 8.00E-81	ISS
UniRef100_I1JVH2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVH2_SOYBN	SoyBase	E_val: 6.00E-117	ISS

Expression Patterns of Glyma04g11400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g11400

Paralog	Evidence	Comments
Glyma06g11081	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g11400 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g104600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g11400

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g11400

Limit To All Plant Sequences

>Glyma04g11400.1   sequence type=CDS   gene model=Glyma04g11400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCAAGAGCAGTGTTATTGTTGGCTATGTGTGTGCTTCCGGCGATGGTTGTGGCCATTCGCCCAGCAAAGAACCCTTTTTGCGTGAAGGGTCGTGTCTACTGTGACCCTTGCCGTGCTGGTTTTGAGACCTCAGCTACCACCTACATTGCTGGTGCTGAGATTATGTTGCAATGCAAGAGCAGGGTTAGCAACGAGGTTGTGTACACGAAGAAGGGGTACACCGACTCAACCGGAGCATACACAATGTACGTGGATGAGGATCACGCAGATCAGATCTGCAGTGCCAAGCTTGTAAGCAGCCCTCACCCTCAATGCAAGGAAGTCACCCCAGGCCGCGACGAAGCCGTCGTGATTCTCACCCGCTACAACGGCATTGCCTCCGACGATAGGTTCGCCAATGCCATGGGCTTCATGTCTCAGGAGGTTGCTTCTGGCTGTGCTGAGATCCTCAGGCAATACCAGGAGTTCGACAATGAGAATTAA

Predicted protein sequences of Glyma04g11400

Limit To All Plant Sequences

>Glyma04g11400.1   sequence type=predicted peptide   gene model=Glyma04g11400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASRAVLLLAMCVLPAMVVAIRPAKNPFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYVDEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVASGCAEILRQYQEFDNEN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain