SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g11290

Feature Type:gene_model
Chromosome:Gm04
Start:9651937
stop:9653740
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g11290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G78080AT Annotation by Michelle Graham. TAIR10: related to AP2 4 | chr1:29364790-29365794 FORWARD LENGTH=334 SoyBaseE_val: 1.00E-96ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010017GO-bp Annotation by Michelle Graham. GO Biological Process: red or far-red light signaling pathway SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0071472GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to salt stress SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_Q4FH87UniRef Annotation by Michelle Graham. Best UniRef hit: Dehydration responsive element-binding protein 3 n=1 Tax=Glycine max RepID=Q4FH87_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q4FH87UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dehydration responsive element-binding protein 3 n=1 Tax=Glycine max RepID=Q4FH87_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma04g11290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g11290
ParalogEvidenceComments
Glyma06g11010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g11290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g103900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g11290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g11290
>Glyma04g11290.1   sequence type=CDS   gene model=Glyma04g11290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTATGATGGATTTTTACAGCAGCAGCACAGAGTTTCAACTTCACTCAGATCCATTCAGGGGTGAACTAATGGAAGTTCTTGAACCTTTTATGAAAAGTCCTTTCTCAACCCCTTCTCCTTCAAATTCTTGTTTTCTTTCTACCTCTTACTCTCCTTCCCCCAACAACTACTCTCCCTCCCTATACTCAAACGGGTTATCATCCATACCCAACACCACCCAAAACTTAATTGGTTTCGGGCAAGGGCAGCCCACATCTCTTGTGGGCCTGAACCACCTAACCCCATCTCAGATCTCTCAGATCCAGGCCCAAATCCAGATCCAGAATCACAGCAACACGCTGAGCTTCCTGGGGCCGAAGCCCATCCCTATGAAGCACGTGGGCATGCCTCCGAAGCCCACGAAGCTATACAGAGGGGTTCGACAGAGGCACTGGGGGAAGTGGGTGGCTGAGATTAGACTCCCGAAGAACCGGACCAGGCTATGGCTGGGAACCTTCGACACCGCCGAGGAAGCCGCTCTGGCGTACGACAAGGCCGCGTACAAGCTCCGAGGTGACTTCGCCAGGCTCAACTTCCCCAACCTCCGACACCAGGGTTCCTCCGTCGGTGGTGACTTCGGGGAGTATAAGCCTCTTCATTCCGCCGTTGACGCCAAGCTTCAGGCCATTTGCGAGGGCCTGGCTGAGCTGCAGAAACAGGGGAAGACCGAGAAGCCTCCGAGGAAAACGCGATCCAAACTCGCTTCTCCGCCAGAGAACGACAACAACAACGACAACAACTCTTGTAAGGTCGAAGCTGCTTCCTCCTCTTCTGAAGGTTCTTCGCCGCTTTCGGTTCTGACTTTCGCTGACGTCAGCGAGCCGCAGTGGGAAGGTGATTCGGATAATTTTAATCTCCAGAAGTACCCCTCTTATGAGATCGACTGGGATTCTCTGTGA
Predicted protein sequences of Glyma04g11290
>Glyma04g11290.1   sequence type=predicted peptide   gene model=Glyma04g11290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAMMDFYSSSTEFQLHSDPFRGELMEVLEPFMKSPFSTPSPSNSCFLSTSYSPSPNNYSPSLYSNGLSSIPNTTQNLIGFGQGQPTSLVGLNHLTPSQISQIQAQIQIQNHSNTLSFLGPKPIPMKHVGMPPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHQGSSVGGDFGEYKPLHSAVDAKLQAICEGLAELQKQGKTEKPPRKTRSKLASPPENDNNNDNNSCKVEAASSSSEGSSPLSVLTFADVSEPQWEGDSDNFNLQKYPSYEIDWDSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo