Report for Sequence Feature Glyma04g11270
Feature Type: gene_model
Chromosome: Gm04
Start: 9631377
stop: 9631850
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g11270
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_UPI000233863A UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233863A related cluster n=1 Tax=unknown RepID=UPI000233863A
SoyBase E_val: 2.00E-09 ISS
Expression Patterns of Glyma04g11270
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Gene model name correspondences to Glyma04g11270 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g103800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g11270
Coding sequences of Glyma04g11270
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g11270.1 sequence type=CDS gene model=Glyma04g11270 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTAGAGTCTAAAAGACTTTATTTTATTAGGATCAATCAATTAAAGTTACAGGTTGACAAATACTGCAACCTGCATCAATCAACTAACAATGCCCAAAGCCAAGGTTCAAACAGTGGAAAAAGAGTCATATTACCTTCCACACTTGTTTGA
Predicted protein sequences of Glyma04g11270
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g11270.1 sequence type=predicted peptide gene model=Glyma04g11270 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLESKRLYFIRINQLKLQVDKYCNLHQSTNNAQSQGSNSGKRVILPSTLV*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
