Report for Sequence Feature Glyma04g11211
Feature Type: gene_model
Chromosome: Gm04
Start: 9500346
stop: 9503393
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g11211
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G39720 AT
Annotation by Michelle Graham. TAIR10: VQ motif-containing protein | chr4:18429992-18430864 REVERSE LENGTH=290
SoyBase E_val: 2.00E-17 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0010089 GO-bp
Annotation by Michelle Graham. GO Biological Process: xylem development
SoyBase N/A ISS
GO:0044036 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF05678 PFAM
VQ motif
JGI ISS
UniRef100_I1JVF8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVF8_SOYBN
SoyBase E_val: 5.00E-120 ISS
UniRef100_Q6AVF5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=2 Tax=Oryza sativa RepID=Q6AVF5_ORYSJ
SoyBase E_val: 6.00E-07 ISS
Expression Patterns of Glyma04g11211
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g11211
Paralog Evidence Comments
Glyma06g10951 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g11211 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g103300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g11211
Coding sequences of Glyma04g11211
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g11211.1 sequence type=CDS gene model=Glyma04g11211 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATTCTGGCAACAGTGGAAGCATCTCTTCTAGCGATGATGAATACGATTCATCATCACACGCTCATCCATCGTTCCTCAATCATTTTGGTTCCATCTCCGACCCGCAACAACCATCTCTTGTTCCTTCTCATCCCTCAATGTTTGATCTTTCCTCAAACTATCTCCACTCTCTCTCACAATCCCACCCAAACCCCCATAATTCCTTCTTAAACTTAGACTCTCAAGGCCAAAGATCTGAACCCAATTGCACCCTCCATGAAAGCCTCCCGTCTTCATCAGCAATACCAACAACAACAAATCAATACTTGTTGGGCCACGACAACCTTAATAATAATGCAAGACAACAACTCCCATCATCCCCACAGACCAACAACCTCATACGCAACTCGAAGAAACGAAGCAGAGCTTCAAGGCGTGCACCCACCACCGTTCTCACCACCGACACCAACAACTTCAGATCCATGGTTCAAGAGTTCACCGGAATCCCTGCACCCCCTTTCTCACCTTCCTTCTCTCGCCGCATCCCTCTTCGCCCAAACCCTTTGCTTTCAACAACTTCATCAAGGACTTTGTTACATAACAACAGCATCTATGTTTCTCCTAATAATAACTCCCTTAATTACCAACTACTTCCCGATCTATCTTTACCCTATCAGCCCCCACCACAGAATCTCATGCAAAATATTCACCCTATTCCCTCATTCCACCCCTCTTCTTCTCTTCATACTCTTGTCCCTACAGGGTTTGGTGCAAAGTCTTTATCCACCATGCCCACGCTTGATGCGCATGATCTGGTGGGTGCACATGTACAAGGTCATCATGAGCATGTGGTTTCTGAGGGCATGTTTCTGAGGAGTGACGGCGGTGGAACTGGAGGAGGGAGAAGAGATCCGTTTAGGTGCTTAGATAATGAGAATAATAATAATTATGGCGGTTGA
Predicted protein sequences of Glyma04g11211
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g11211.1 sequence type=predicted peptide gene model=Glyma04g11211 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDSGNSGSISSSDDEYDSSSHAHPSFLNHFGSISDPQQPSLVPSHPSMFDLSSNYLHSLSQSHPNPHNSFLNLDSQGQRSEPNCTLHESLPSSSAIPTTTNQYLLGHDNLNNNARQQLPSSPQTNNLIRNSKKRSRASRRAPTTVLTTDTNNFRSMVQEFTGIPAPPFSPSFSRRIPLRPNPLLSTTSSRTLLHNNSIYVSPNNNSLNYQLLPDLSLPYQPPPQNLMQNIHPIPSFHPSSSLHTLVPTGFGAKSLSTMPTLDAHDLVGAHVQGHHEHVVSEGMFLRSDGGGTGGGRRDPFRCLDNENNNNYGG*