Glyma04g11030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g11030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g11030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g11030

Feature Type:	gene_model
Chromosome:	Gm04
Start:	9305965
stop:	9308089
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g11030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G64440	AT	Annotation by Michelle Graham. TAIR10: fatty acid amide hydrolase \| chr5:25766229-25770260 FORWARD LENGTH=607	SoyBase	E_val: 8.00E-25	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0070291	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-acylethanolamine metabolic process	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004040	GO-mf	Annotation by Michelle Graham. GO Molecular Function: amidase activity	SoyBase	N/A	ISS
GO:0016884	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbon-nitrogen ligase activity, with glutamine as amido-N-donor	SoyBase	N/A	ISS
GO:0047412	GO-mf	Annotation by Michelle Graham. GO Molecular Function: N-(long-chain-acyl)ethanolamine deacylase activity	SoyBase	N/A	ISS
PTHR11895	Panther	AMIDASE	JGI		ISS
PTHR11895:SF7	Panther	GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A	JGI		ISS
PF01425	PFAM	Amidase	JGI		ISS
UniRef100_G7J2M6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutamyl-tRNA(Gln) amidotransferase subunit A n=1 Tax=Medicago truncatula RepID=G7J2M6_MEDTR	SoyBase	E_val: 4.00E-39	ISS
UniRef100_UPI0002339EEB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339EEB related cluster n=1 Tax=unknown RepID=UPI0002339EEB	SoyBase	E_val: 6.00E-42	ISS

Expression Patterns of Glyma04g11030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g11030 not represented in the dataset	Glyma04g11030 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g11030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g11030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g11030

Limit To All Plant Sequences

>Glyma04g11030.1   sequence type=CDS   gene model=Glyma04g11030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTTTTTTTTGTGCAATCAAAATTGGAGTGTCCAATACTTGGAACCTTACTATTGTTCATATTGAAAGGAAACAATCTTATTCATTGGGGAAACCTATCTCTGTGCTAGACGGAGTTCCTGTTGCTATCAAGGATGAGATAGATTGTTTGATCCAACAAAAGGAAGGTACAACATGGCTGCACAAAGAAAGACCTTGCAGCGATGATGCCTACTGCATTAAGCGTCTAAGACTATGTGGCGCTATACTTGTTGGGAAAACCAATATGCATGAACTAGGATGTGGGAACCATATCAAGGAATGCCTGCTAGAAACCCATATGATACCAATAAGATTGTATGAGGTTCTTCTAGTGGATTTGCTTCTCTCGTGTCTGTCAGACTGTACCAGAGAAATCAGCATTCATTATTGCTTTGTAGCATTGAACATATATAAGAATTTTCTAGGATCTGTAAGGATGCCAGCTGCTCTTTGTGGTGTTGTTGGTCTAAAACCAACTTTTGAACGTATACCTCATGAAGGGTATGTATTCATTTTTTGTTTTATCATGTTTAAATATTTGAGGAGTTCTTCCCCTAAATTGGAATGTTGGGATGGTTGGAATACAAGCAGTTATGCGGCTATTAGTGTTATAACTATCAGTTGTTGGTCCCATGTGCTATTCTTGTTGAGGGTGTCAAGTTTTCTCTTTTATACTTGCAATCGACTGTATGTAATTTATGAAGAGAAAAATCCTCCTAACATGTATTATGCTTTTCATTCCTATACAGGCAAGCCAAGGGTTGAA

Predicted protein sequences of Glyma04g11030

Limit To All Plant Sequences

>Glyma04g11030.1   sequence type=predicted peptide   gene model=Glyma04g11030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VFFCAIKIGVSNTWNLTIVHIERKQSYSLGKPISVLDGVPVAIKDEIDCLIQQKEGTTWLHKERPCSDDAYCIKRLRLCGAILVGKTNMHELGCGNHIKECLLETHMIPIRLYEVLLVDLLLSCLSDCTREISIHYCFVALNIYKNFLGSVRMPAALCGVVGLKPTFERIPHEGYVFIFCFIMFKYLRSSSPKLECWDGWNTSSYAAISVITISCWSHVLFLLRVSSFLFYTCNRLYVIYEEKNPPNMYYAFHSYTGKPRVE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain