SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g10860

Feature Type:gene_model
Chromosome:Gm04
Start:9111517
stop:9113034
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G64260AT Annotation by Michelle Graham. TAIR10: EXORDIUM like 2 | chr5:25703980-25704897 FORWARD LENGTH=305 SoyBaseE_val: 7.00E-125ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0046685GO-bp Annotation by Michelle Graham. GO Biological Process: response to arsenic-containing substance SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04674PFAM Phosphate-induced protein 1 conserved region JGI ISS
UniRef100_E4MW96UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-07-O09 n=1 Tax=Eutrema halophilum RepID=E4MW96_THEHA SoyBaseE_val: 1.00E-122ISS
UniRef100_I1JVC6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JVC6_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g10690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g100200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g10860.2   sequence type=CDS   gene model=Glyma04g10860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTAATTTTAAGGTTGGCAATTTTTGTGGCCTCCCTTGTAGTAGTCGTCCAATCCCATGTTCCAAACATTTGGGAAGCCAAGCCCTTCCACCACATGTTGTCTTTGGTTCAGCCAGACCCTGTTGTCCTCAACTACCACAGGGGTCCACTCCTTAAGGGAAACGTCACCGTTCATATCAACTGGTACGGCAACTTCACACCCATTCACCGTTCCATCATCGTTGATTTCATCCAATCCCTTGGTTCCATTCCCCACTCTCGTCACCACCCATCACCCTTTTCGTGGTGGCGAATCACCGCGAGGTACAGAGGAGGCCCCCGCACCCTCACCGTAGGGAATCAAACCCTTGACAACACCTACTCCCTCGGTAAATCACTTAAAACAAGCCACCTCCTCGCACTCGCTTCCAAAAATTCACCACCAACAACTCGCAGTAACGCTAACGCCATCCACGTGCTGCTAACCTCTGCTGACGTGGCGGTGGATGGTTTCTGCATGAGCCGATGTGGGACCCACGGGTCGGGTCGGGTTGCAAAGAGAAGGATCGCGTTCGCGTGGGTGGGTAACCCGGTTACGCAGTGTCCTGGGGAGTGCGCGTGGCCGTTCCACCAGCCGGTGTACGGACCGCAGACGCCGCCGCTGGTTCCGCCGAACGGCGACGTTGGCGTGGACGGGATGCTGATAAGTTTGGCGACGGTGCTCGCCGGAGCGGTGACGAACCCGTTCGGGAACGGGTACTACCAAGGGTCGGTGACGGCGCCGCTGGAGGCGGTGTCGGCTTGCGCCGGAATATTCGGAAAAGGGGCGTATCCGGGTTACACGGGTAACGTTTTGGTGGATAACGTAACGGGAGCTAGCTACAACGCGTTGGGTTTGCACGGTCGCAAGTTTCTGTTACCGGCGATGTGGGACCCCGTCACGTCTACATGCAAAACGCTCGTTTGA

>Glyma04g10860.2   sequence type=predicted peptide   gene model=Glyma04g10860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLILRLAIFVASLVVVVQSHVPNIWEAKPFHHMLSLVQPDPVVLNYHRGPLLKGNVTVHINWYGNFTPIHRSIIVDFIQSLGSIPHSRHHPSPFSWWRITARYRGGPRTLTVGNQTLDNTYSLGKSLKTSHLLALASKNSPPTTRSNANAIHVLLTSADVAVDGFCMSRCGTHGSGRVAKRRIAFAWVGNPVTQCPGECAWPFHQPVYGPQTPPLVPPNGDVGVDGMLISLATVLAGAVTNPFGNGYYQGSVTAPLEAVSACAGIFGKGAYPGYTGNVLVDNVTGASYNALGLHGRKFLLPAMWDPVTSTCKTLV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo