Glyma04g10771 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g10771

Feature Type:	gene_model
Chromosome:	Gm04
Start:	9033415
stop:	9034383
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g10771

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G24710	AT	Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein \| chr4:12745752-12748995 REVERSE LENGTH=475	SoyBase	E_val: 2.00E-19	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
UniRef100_G7J4A8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thyroid receptor-interacting protein n=1 Tax=Medicago truncatula RepID=G7J4A8_MEDTR	SoyBase	E_val: 5.00E-26	ISS
UniRef100_I1KCB2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KCB2_SOYBN	SoyBase	E_val: 4.00E-49	ISS

Expression Patterns of Glyma04g10771

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g10771 not represented in the dataset	Glyma04g10771 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g10771 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g10771

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g10771

Limit To All Plant Sequences

>Glyma04g10771.1   sequence type=CDS   gene model=Glyma04g10771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGCTCTCATGGAGACGGAGCTCACAACCGACCAAAACGGTGCTGCTTACCAACACCCACTTCCTATTCCCGAGGACAAAGTTCTTGTCCCTGTCGAGGTAACCCTAAAACCTTCAAGCACAACTAAAATTGACAATGTTCGTTCCGCCGTTAAGGGGAAGTTGGAAAAAAGGAGTTTGAGCTATAACGATGGACCCGTTCTAGTGCCTCTTGATGATGCGTTTCTCGCAGATAACGTGCAAAGAATATGCGTTTGTGGATGTGATACTGGGGTTGATCCATTCCTTGTTTCATGGAATTGGTAG

Predicted protein sequences of Glyma04g10771

Limit To All Plant Sequences

>Glyma04g10771.1   sequence type=predicted peptide   gene model=Glyma04g10771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSALMETELTTDQNGAAYQHPLPIPEDKVLVPVEVTLKPSSTTKIDNVRSAVKGKLEKRSLSYNDGPVLVPLDDAFLADNVQRICVCGCDTGVDPFLVSWNW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain