Report for Sequence Feature Glyma04g10550
Feature Type: gene_model
Chromosome: Gm04
Start: 8747799
stop: 8749671
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g10550
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G28230 AT
Annotation by Michelle Graham. TAIR10: purine permease 1 | chr1:9862200-9864554 REVERSE LENGTH=356
SoyBase E_val: 8.00E-143 ISS
GO:0006863 GO-bp
Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport
SoyBase N/A ISS
GO:0010184 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinin transport
SoyBase N/A ISS
GO:0015931 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound transport
SoyBase N/A ISS
GO:0005887 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0005345 GO-mf
Annotation by Michelle Graham. GO Molecular Function: purine nucleobase transmembrane transporter activity
SoyBase N/A ISS
GO:0015211 GO-mf
Annotation by Michelle Graham. GO Molecular Function: purine nucleoside transmembrane transporter activity
SoyBase N/A ISS
PF00892 PFAM
EamA-like transporter family
JGI ISS
PF03151 PFAM
Triose-phosphate Transporter family
JGI ISS
UniRef100_G7J4H5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Purine permease n=1 Tax=Medicago truncatula RepID=G7J4H5_MEDTR
SoyBase E_val: 0 ISS
UniRef100_I1JV99 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JV99_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma04g10550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g10550
Paralog Evidence Comments
Glyma06g10420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g10550 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g097500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g10550
Coding sequences of Glyma04g10550
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g10550.1 sequence type=CDS gene model=Glyma04g10550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCGAAGGAAGAAACGAAGACAAAGACAGAACCATGAAGCGCCTTCTTCTCATAACAAACTGTCTCTTACTCACCATCGGCACCTCCGGTGGGCCCCTCGTGATGCGTCTCTACTTCCTTCACGGCGGCCACCGCGTCTGGCTCTCCAGCTTCCTCGAAACCGCCGGCTTCCCCCTCATGCTCCTACCCCTCGCCGTATCGTACTTCCGTCGCCGCCGCACCGCCGCCGCCGGAACCTCCAAACCGAAATTAATCTCTATGAAGCCCCCTCTCCTCGCCGCCTCCGCCTTCATCGGAATCCTCACCGGCCTCGACGACTACCTTTACGCCTACGGCGTGGCGAGGCTTCCGGTCTCCACTTCCGCCCTCATCATCGCAACGCAACTCGGCTTCACCGCGTTCTTCGCGTTCCTTCTCGTGAGGCAGAAGTTCACGGCGTACTCCGTAAACGCCGTCGTTTTGCTCACTGTCGGCGCCGGCGTTTTGGCGCTTCACACCAGCGGAGACCGTCCCCCTGGCGAGTCCGTTAAGGAATATGTTATGGGCTTTGTGATGACAGTGATCGCTGCGGCATTGTATGGATTCATTTTACCCTTGGTGGAGTTGGTGTACAAAAAAATCAAACAGCCTCTTACTTACTCTCTTGTCATGGAGATTCAGTTCGTTATGTGCTTCTCCGCCACTCTCTTTTGCCTCCTTGGAATGATCATCAACAATGACTTTAAGGTGATTCCGAGGGAAGCCAAAAAATTTGAGCACGGAGAAGGAAGTTACTATGCTGTTTTGGTGGGGAGTGCAATATTATGGCAGGCTTTTTTCTTGGGGGCGATTGGGGTTATATTTTGTGCCTCGTCTTTGTTTTCTGGTATTTTGATTGCGGTGTTGCTACCCGTAACGGAAGTGTTGGCGGTTATTTTCTACAAAGAAAAGTTTCAAGCCGAAAAAGGGGTTTCTCTGTTGCTCTCGCTTTGGGGCATGGTGTCCTACTTCTATGGGGAGATTAAACACTCAAAGAAAATGAAGATGAAGAACAGTGATACTGAAGCAGAACTGGCACAACAGTATTCGTGA
Predicted protein sequences of Glyma04g10550
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g10550.1 sequence type=predicted peptide gene model=Glyma04g10550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAEGRNEDKDRTMKRLLLITNCLLLTIGTSGGPLVMRLYFLHGGHRVWLSSFLETAGFPLMLLPLAVSYFRRRRTAAAGTSKPKLISMKPPLLAASAFIGILTGLDDYLYAYGVARLPVSTSALIIATQLGFTAFFAFLLVRQKFTAYSVNAVVLLTVGAGVLALHTSGDRPPGESVKEYVMGFVMTVIAAALYGFILPLVELVYKKIKQPLTYSLVMEIQFVMCFSATLFCLLGMIINNDFKVIPREAKKFEHGEGSYYAVLVGSAILWQAFFLGAIGVIFCASSLFSGILIAVLLPVTEVLAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEIKHSKKMKMKNSDTEAELAQQYS*