Glyma04g10550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g10550

Feature Type:	gene_model
Chromosome:	Gm04
Start:	8747799
stop:	8749671
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g10550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G28230	AT	Annotation by Michelle Graham. TAIR10: purine permease 1 \| chr1:9862200-9864554 REVERSE LENGTH=356	SoyBase	E_val: 8.00E-143	ISS
GO:0006863	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport	SoyBase	N/A	ISS
GO:0010184	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin transport	SoyBase	N/A	ISS
GO:0015931	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound transport	SoyBase	N/A	ISS
GO:0005887	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005345	GO-mf	Annotation by Michelle Graham. GO Molecular Function: purine nucleobase transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015211	GO-mf	Annotation by Michelle Graham. GO Molecular Function: purine nucleoside transmembrane transporter activity	SoyBase	N/A	ISS
PF00892	PFAM	EamA-like transporter family	JGI		ISS
PF03151	PFAM	Triose-phosphate Transporter family	JGI		ISS
UniRef100_G7J4H5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Purine permease n=1 Tax=Medicago truncatula RepID=G7J4H5_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1JV99	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JV99_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g10550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g10550

Paralog	Evidence	Comments
Glyma06g10420	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g10550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g097500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g10550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g10550

Limit To All Plant Sequences

>Glyma04g10550.1   sequence type=CDS   gene model=Glyma04g10550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGAAGGAAGAAACGAAGACAAAGACAGAACCATGAAGCGCCTTCTTCTCATAACAAACTGTCTCTTACTCACCATCGGCACCTCCGGTGGGCCCCTCGTGATGCGTCTCTACTTCCTTCACGGCGGCCACCGCGTCTGGCTCTCCAGCTTCCTCGAAACCGCCGGCTTCCCCCTCATGCTCCTACCCCTCGCCGTATCGTACTTCCGTCGCCGCCGCACCGCCGCCGCCGGAACCTCCAAACCGAAATTAATCTCTATGAAGCCCCCTCTCCTCGCCGCCTCCGCCTTCATCGGAATCCTCACCGGCCTCGACGACTACCTTTACGCCTACGGCGTGGCGAGGCTTCCGGTCTCCACTTCCGCCCTCATCATCGCAACGCAACTCGGCTTCACCGCGTTCTTCGCGTTCCTTCTCGTGAGGCAGAAGTTCACGGCGTACTCCGTAAACGCCGTCGTTTTGCTCACTGTCGGCGCCGGCGTTTTGGCGCTTCACACCAGCGGAGACCGTCCCCCTGGCGAGTCCGTTAAGGAATATGTTATGGGCTTTGTGATGACAGTGATCGCTGCGGCATTGTATGGATTCATTTTACCCTTGGTGGAGTTGGTGTACAAAAAAATCAAACAGCCTCTTACTTACTCTCTTGTCATGGAGATTCAGTTCGTTATGTGCTTCTCCGCCACTCTCTTTTGCCTCCTTGGAATGATCATCAACAATGACTTTAAGGTGATTCCGAGGGAAGCCAAAAAATTTGAGCACGGAGAAGGAAGTTACTATGCTGTTTTGGTGGGGAGTGCAATATTATGGCAGGCTTTTTTCTTGGGGGCGATTGGGGTTATATTTTGTGCCTCGTCTTTGTTTTCTGGTATTTTGATTGCGGTGTTGCTACCCGTAACGGAAGTGTTGGCGGTTATTTTCTACAAAGAAAAGTTTCAAGCCGAAAAAGGGGTTTCTCTGTTGCTCTCGCTTTGGGGCATGGTGTCCTACTTCTATGGGGAGATTAAACACTCAAAGAAAATGAAGATGAAGAACAGTGATACTGAAGCAGAACTGGCACAACAGTATTCGTGA

Predicted protein sequences of Glyma04g10550

Limit To All Plant Sequences

>Glyma04g10550.1   sequence type=predicted peptide   gene model=Glyma04g10550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEGRNEDKDRTMKRLLLITNCLLLTIGTSGGPLVMRLYFLHGGHRVWLSSFLETAGFPLMLLPLAVSYFRRRRTAAAGTSKPKLISMKPPLLAASAFIGILTGLDDYLYAYGVARLPVSTSALIIATQLGFTAFFAFLLVRQKFTAYSVNAVVLLTVGAGVLALHTSGDRPPGESVKEYVMGFVMTVIAAALYGFILPLVELVYKKIKQPLTYSLVMEIQFVMCFSATLFCLLGMIINNDFKVIPREAKKFEHGEGSYYAVLVGSAILWQAFFLGAIGVIFCASSLFSGILIAVLLPVTEVLAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEIKHSKKMKMKNSDTEAELAQQYS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain