SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g10170

Feature Type:gene_model
Chromosome:Gm04
Start:8406893
stop:8407963
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g10170
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12345AT Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: chloroplast; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr3:3930333-3930893 REVERSE LENGTH=186 SoyBaseE_val: 3.00E-54ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
UniRef100_I1JV77UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JV77_SOYBN SoyBaseE_val: 1.00E-131ISS
UniRef100_Q9LHH3UniRef Annotation by Michelle Graham. Most informative UniRef hit: FKBP-type peptidyl-prolyl cis-trans isomerase, putative n=1 Tax=Arabidopsis thaliana RepID=Q9LHH3_ARATH SoyBaseE_val: 1.00E-51ISS

Expression Patterns of Glyma04g10170
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g10170
ParalogEvidenceComments
Glyma06g10160 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g10170 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g095200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g10170
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g10170
>Glyma04g10170.1   sequence type=CDS   gene model=Glyma04g10170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGATGTTAGCTTCACCATCTGTGAAACTCTCGCTCCCATTCCCTCTTTCTTCTTCCAAACCCAACCCTCGCAGGCCCTTCACCATCCGAGCCACCGAGCCCGAAACCCCACTCTCCGGTTCGGACCCATCCCAGCCCGAACCGGACCCTTCCGACGACGCCTTCGACGACCGCATCAACCAGCTCCGCCTCCGGTACCGCAGCGGCACCGGTAAGAAGGCGGAGCTCCGAAAGAACAAAAAATCAAAGAAAGGAACCTCCGGATCCGGGTCGGGCATGTACCTGCCGCCGGTGCCGCTGAAGGAACCGGTTTCCGGCGGCGTGAAGGTGGAGCTCGGGTTCAGCCAGTACAGCGAGCGATTGAACGGTCGCATTGCGATTCTAGGTCTGGCGGCGCTGGTGCTGGTGGAGCTCGCGACGGGGAAGGGTGTCATTAACTACCACACGCCGGCTATTATTCTGATTCAGATATATTTCGTGGCTGCGGTTGGAGCTGTCTTTGTTAAGTATGAGAAGGAGAAGATCAGCGTTTGGCCCCAAACTGATTCTTCAACTAACAAATAA
Predicted protein sequences of Glyma04g10170
>Glyma04g10170.1   sequence type=predicted peptide   gene model=Glyma04g10170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMLASPSVKLSLPFPLSSSKPNPRRPFTIRATEPETPLSGSDPSQPEPDPSDDAFDDRINQLRLRYRSGTGKKAELRKNKKSKKGTSGSGSGMYLPPVPLKEPVSGGVKVELGFSQYSERLNGRIAILGLAALVLVELATGKGVINYHTPAIILIQIYFVAAVGAVFVKYEKEKISVWPQTDSSTNK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo