SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g10015

Feature Type:gene_model
Chromosome:Gm04
Start:8282549
stop:8282761
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g10015
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24540AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 24 | chr4:12671160-12673645 REVERSE LENGTH=220 SoyBaseE_val: 6.00E-29ISS
GO:0000060GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus, translocation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0010076GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of floral meristem identity SoyBaseN/AISS
GO:0010077GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of inflorescence meristem identity SoyBaseN/AISS
GO:0010220GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of vernalization response SoyBaseN/AISS
GO:0010582GO-bp Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048438GO-bp Annotation by Michelle Graham. GO Biological Process: floral whorl development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046982GO-mf Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity SoyBaseN/AISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
UniRef100_B0FLP5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dormancy associated MADS-box protein n=1 Tax=Euphorbia esula RepID=B0FLP5_EUPES SoyBaseE_val: 9.00E-29ISS
UniRef100_UPI0002339F3CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339F3C related cluster n=1 Tax=unknown RepID=UPI0002339F3C SoyBaseE_val: 3.00E-31ISS

Expression Patterns of Glyma04g10015
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g10015 not represented in the dataset
Glyma04g10015 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g10015 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g093900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g10015
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g10015
>Glyma04g10015.1   sequence type=CDS   gene model=Glyma04g10015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTAATTTATAAAATGACGAGGGCGAAGATAAAGATAAAGAAAATCGACAACATAACGGCGAGGCAAGTAACATTTTCTAAGAGGAGGCGAGGGCTGTTCAAGAAAGCTGAAGAGCTTTCTGTGCTATGCGATGCTGAGGTTGGTCTCATTGTTTTCTCATCTACCGGGAAGCTCTTTGATTATAGCAACGCCAGGTACGTACATACGGACTAG
Predicted protein sequences of Glyma04g10015
>Glyma04g10015.1   sequence type=predicted peptide   gene model=Glyma04g10015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LIYKMTRAKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGLIVFSSTGKLFDYSNARYVHTD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo