SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g10000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g10000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g10000

Feature Type:gene_model
Chromosome:Gm04
Start:8269666
stop:8270232
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g10000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62710AT Annotation by Michelle Graham. TAIR10: beta vacuolar processing enzyme | chr1:23224070-23226857 REVERSE LENGTH=486 SoyBaseE_val: 2.00E-41ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006624GO-bp Annotation by Michelle Graham. GO Biological Process: vacuolar protein processing SoyBaseN/AISS
GO:0004197GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase activity SoyBaseN/AISS
PTHR12000Panther HEMOGLOBINASE FAMILY MEMBER JGI ISS
PTHR12000:SF2Panther HEMOGLOBINASE JGI ISS
PF01650PFAM Peptidase C13 family JGI ISS
UniRef100_I1K0K8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K0K8_SOYBN SoyBaseE_val: 1.00E-50ISS
UniRef100_Q9LLQ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Seed maturation protein PM40 n=1 Tax=Glycine max RepID=Q9LLQ5_SOYBN SoyBaseE_val: 3.00E-48ISS

Expression Patterns of Glyma04g10000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g10000 not represented in the dataset
Glyma04g10000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g10000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g10000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g10000
>Glyma04g10000.1   sequence type=CDS   gene model=Glyma04g10000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATTACACCGATGAGAATGTCTCGGTCCAAAACCTCATTGTCGTTATTCTTGGGGACAAGAATAAAGTGAAGGGAGGAAGTGGGAAAGTGATCAATAGCAAACTCGAGGACAAAATATTTATATCTACTTTAATCATGGAGGTCCGGGAGTTCTTAGTCATATACGCGGAAGCTTGTGATATACGAGGAAGCATGTTTGAGGGTATGATGCCTAAGGATTTGAAGATTTATGCCACAACTGCATCCAATGCACAAGAGAATAGTTGGGGAACTTATTGTCTTGGAATGGATCCTTCTCCACCTCCAGAGTACATCATTTGCCTAGGGGATTTGTACAGTGTTGCTTGGATGGAAGAT
Predicted protein sequences of Glyma04g10000
>Glyma04g10000.1   sequence type=predicted peptide   gene model=Glyma04g10000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DYTDENVSVQNLIVVILGDKNKVKGGSGKVINSKLEDKIFISTLIMEVREFLVIYAEACDIRGSMFEGMMPKDLKIYATTASNAQENSWGTYCLGMDPSPPPEYIICLGDLYSVAWMED






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo