Glyma04g10000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g10000

Feature Type:	gene_model
Chromosome:	Gm04
Start:	8269666
stop:	8270232
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g10000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G62710	AT	Annotation by Michelle Graham. TAIR10: beta vacuolar processing enzyme \| chr1:23224070-23226857 REVERSE LENGTH=486	SoyBase	E_val: 2.00E-41	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0006624	GO-bp	Annotation by Michelle Graham. GO Biological Process: vacuolar protein processing	SoyBase	N/A	ISS
GO:0004197	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase activity	SoyBase	N/A	ISS
PTHR12000	Panther	HEMOGLOBINASE FAMILY MEMBER	JGI		ISS
PTHR12000:SF2	Panther	HEMOGLOBINASE	JGI		ISS
PF01650	PFAM	Peptidase C13 family	JGI		ISS
UniRef100_I1K0K8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K0K8_SOYBN	SoyBase	E_val: 1.00E-50	ISS
UniRef100_Q9LLQ5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Seed maturation protein PM40 n=1 Tax=Glycine max RepID=Q9LLQ5_SOYBN	SoyBase	E_val: 3.00E-48	ISS

Expression Patterns of Glyma04g10000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g10000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g10000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g10000

Limit To All Plant Sequences

>Glyma04g10000.1   sequence type=CDS   gene model=Glyma04g10000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATTACACCGATGAGAATGTCTCGGTCCAAAACCTCATTGTCGTTATTCTTGGGGACAAGAATAAAGTGAAGGGAGGAAGTGGGAAAGTGATCAATAGCAAACTCGAGGACAAAATATTTATATCTACTTTAATCATGGAGGTCCGGGAGTTCTTAGTCATATACGCGGAAGCTTGTGATATACGAGGAAGCATGTTTGAGGGTATGATGCCTAAGGATTTGAAGATTTATGCCACAACTGCATCCAATGCACAAGAGAATAGTTGGGGAACTTATTGTCTTGGAATGGATCCTTCTCCACCTCCAGAGTACATCATTTGCCTAGGGGATTTGTACAGTGTTGCTTGGATGGAAGAT

Predicted protein sequences of Glyma04g10000

Limit To All Plant Sequences

>Glyma04g10000.1   sequence type=predicted peptide   gene model=Glyma04g10000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DYTDENVSVQNLIVVILGDKNKVKGGSGKVINSKLEDKIFISTLIMEVREFLVIYAEACDIRGSMFEGMMPKDLKIYATTASNAQENSWGTYCLGMDPSPPPEYIICLGDLYSVAWMED

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain