Report for Sequence Feature Glyma04g09990
Feature Type: gene_model
Chromosome: Gm04
Start: 8262880
stop: 8263555
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g09990
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G64030 AT
Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr5:25624965-25628257 FORWARD LENGTH=829
SoyBase E_val: 9.00E-80 ISS
GO:0005768 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endosome
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0005802 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network
SoyBase N/A ISS
GO:0008168 GO-mf
Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity
SoyBase N/A ISS
PF03141 PFAM
Putative methyltransferase
JGI ISS
UniRef100_G7JC39 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ankyrin-like protein n=1 Tax=Medicago truncatula RepID=G7JC39_MEDTR
SoyBase E_val: 7.00E-80 ISS
UniRef100_I1KBK8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KBK8_SOYBN
SoyBase E_val: 4.00E-91 ISS
Expression Patterns of Glyma04g09990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma04g09990 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma04g09990
Coding sequences of Glyma04g09990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g09990.1 sequence type=CDS gene model=Glyma04g09990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GAGTTGTGGCCAGCCAAACTGACCAAAGTGCCTTATTGGTTGTCGAGTTCCCAAGTTGGAGTTTATGGAAAGCCAGCCCCTCAAGATTTCACTGCTGATTATGAACATTGGAAACGTGTAATGTCCAAGTCTTATCTAGACGGGATGGGAATTAAATGGTCAAATGTACGCAATGTCATTGATATGAGATCTATCTATGGAGGATTTGCTATAGCTTCGAGAGATTTGAATGTTTGGGTCATGAATGTGGTTACAATAGACTCCCCAGATACTCTTCCCATTATTTATGAACGAAGTCTTTTTGGTATATATCATGATTGGTGTGAATCATTTAGCACCTATACTAGGACCTATGATCTCCTCCATGCTGATCATTTGTTTTCAAAGCTTAAGAAGAACAAACTTTTGTGCAATTTGGTTGCTATAGTGGCTAAGGGTGATCAGATTCTTAGGCCTAAAAACCAAATCACT
Predicted protein sequences of Glyma04g09990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g09990.1 sequence type=predicted peptide gene model=Glyma04g09990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ELWPAKLTKVPYWLSSSQVGVYGKPAPQDFTADYEHWKRVMSKSYLDGMGIKWSNVRNVIDMRSIYGGFAIASRDLNVWVMNVVTIDSPDTLPIIYERSLFGIYHDWCESFSTYTRTYDLLHADHLFSKLKKNKLLCNLVAIVAKGDQILRPKNQIT