SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g09980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g09980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g09980

Feature Type:gene_model
Chromosome:Gm04
Start:8259244
stop:8259384
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52560AT Annotation by Michelle Graham. TAIR10: ubiquitin E2 variant 1D-4 | chr3:19494678-19495954 REVERSE LENGTH=164 SoyBaseE_val: 5.00E-25ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006301GO-bp Annotation by Michelle Graham. GO Biological Process: postreplication repair SoyBaseN/AISS
GO:0006605GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006974GO-bp Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0031372GO-cc Annotation by Michelle Graham. GO Cellular Compartment: UBC13-MMS2 complex SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016881GO-mf Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity SoyBaseN/AISS
PTHR24067Panther UBIQUITIN-CONJUGATING ENZYME E2 JGI ISS
PTHR24067:SF8Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_F4J6Z1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-conjugating enzyme E2 variant 1D n=1 Tax=Arabidopsis thaliana RepID=F4J6Z1_ARATH SoyBaseE_val: 2.00E-22ISS
UniRef100_I1JQ65UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JQ65_SOYBN SoyBaseE_val: 3.00E-23ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g09980 not represented in the dataset

Glyma04g09980 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g09980.1   sequence type=CDS   gene model=Glyma04g09980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTCCTAGGAACTTCAGATTGCTGGAGGAGCTTCAACGTGGTGAAAAAGGAATTGGAGATGACACAGGTAGCTATGGAATGGATGATGGTGATGACATTTACATGCACTCTTGGACTGGCACCATTATTGGCCCCCATAAT

>Glyma04g09980.1   sequence type=predicted peptide   gene model=Glyma04g09980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VPRNFRLLEELQRGEKGIGDDTGSYGMDDGDDIYMHSWTGTIIGPHN







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo