Report for Sequence Feature Glyma04g09920
Feature Type: gene_model
Chromosome: Gm04
Start: 8215472
stop: 8220014
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g09920
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G28200 AT
Annotation by Michelle Graham. TAIR10: FH interacting protein 1 | chr1:9850395-9852300 REVERSE LENGTH=259
SoyBase E_val: 4.00E-118 ISS
GO:0006623 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0016197 GO-bp
Annotation by Michelle Graham. GO Biological Process: endosomal transport
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF02893 PFAM
GRAM domain
JGI ISS
UniRef100_G7J579 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: GLABRA2 expression modulator n=1 Tax=Medicago truncatula RepID=G7J579_MEDTR
SoyBase E_val: 2.00E-131 ISS
UniRef100_I1JV52 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JV52_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma04g09920
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g09920
Paralog Evidence Comments
Glyma06g09980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g09920 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g093400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g09920
Coding sequences of Glyma04g09920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g09920.1 sequence type=CDS gene model=Glyma04g09920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTGGCGACGCCCCAACCCAAACCCAAACCCAAGCCACCGACACCAAACCAGAAGAAACCCACACCCACACCCAAACCATCACTACCAAACCGGAAGAATCTCATTCTCAATCTCAGTCTCAGCCTCAGCCTCACACTGCCGATTATGCTCCATACCCTAAACTGGACCCCACCGATGTTGCGCCACCACTCAACACTGAATCTCGCGCTCCCATTTCCGAAGATGCTGCCACTACTATGCCCAAAGACTCCAATCCCTATGTCACTCCTGCGCCAGTTCCTGCTTCTTCTACCAAGACTACTTTAGATTCCGTGAAAGACGTTCTCGGGAAATGGGGGAAGAAAGCCGCCGAGGCCACCAAGAAGGCCGAGGATCTCGCCGGCAACATGTGGCAGCACTTGAAAACGGGACCGAGTTTTGCGGATGCTGCTGTGGGGAGGATTGCTCAGGGGACTAAAGTACTTGCAGAAGGAGGGTATGAGAAGATCTTTAGGCAAACATTTGAGACAGTTCCAGAGGAGCAGCTTCTGAAAACTTATGCATGCTACTTGTCTACCTCGGCTGGACCTGTGATGGGTGTCTTATATTTGTCAACGGCAAAGCTGGCATTTTGTAGTGATAACCCTCTTTCTTACCAAGTGGGTGGTGACCAGACTCAATGGAGCTATTATAAGGTGGTCATTCCATTGCACCAGCTGAGAGCTGTAAACGCATCAACAAGCAGAACCAACCAATCTGAAAAGTATATACAGATTATCTCTGTTGACAACCATGAATTTTGGTTTATGGGCTTTGTGCACTATGACAGCGCTGTTAAAAATATTCAAGGAGCATTGCAGCCTCATTGA
Predicted protein sequences of Glyma04g09920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g09920.1 sequence type=predicted peptide gene model=Glyma04g09920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSGDAPTQTQTQATDTKPEETHTHTQTITTKPEESHSQSQSQPQPHTADYAPYPKLDPTDVAPPLNTESRAPISEDAATTMPKDSNPYVTPAPVPASSTKTTLDSVKDVLGKWGKKAAEATKKAEDLAGNMWQHLKTGPSFADAAVGRIAQGTKVLAEGGYEKIFRQTFETVPEEQLLKTYACYLSTSAGPVMGVLYLSTAKLAFCSDNPLSYQVGGDQTQWSYYKVVIPLHQLRAVNASTSRTNQSEKYIQIISVDNHEFWFMGFVHYDSAVKNIQGALQPH*