SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g09820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g09820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g09820

Feature Type:gene_model
Chromosome:Gm04
Start:8085972
stop:8088701
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10450AT Annotation by Michelle Graham. TAIR10: G-box regulating factor 6 | chr5:3284452-3286261 REVERSE LENGTH=248 SoyBaseE_val: 2.00E-157ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009742GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid mediated signaling pathway SoyBaseN/AISS
GO:0016310GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorylation SoyBaseN/AISS
GO:0032880GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein localization SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0019904GO-mf Annotation by Michelle Graham. GO Molecular Function: protein domain specific binding SoyBaseN/AISS
GO:0045309GO-mf Annotation by Michelle Graham. GO Molecular Function: protein phosphorylated amino acid binding SoyBaseN/AISS
KOG0841 KOG Multifunctional chaperone (14-3-3 family) JGI ISS
PTHR18860Panther 14-3-3 JGI ISS
PF00244PFAM 14-3-3 protein JGI ISS
UniRef100_Q96451UniRef Annotation by Michelle Graham. Most informative UniRef hit: 14-3-3-like protein B (Fragment) n=1 Tax=Glycine max RepID=1433B_SOYBN SoyBaseE_val: 2.00E-179ISS
UniRef100_UPI00018C7074UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C7074 related cluster n=1 Tax=unknown RepID=UPI00018C7074 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g09820 not represented in the dataset

Glyma04g09820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g09890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g092600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g09820.1   sequence type=CDS   gene model=Glyma04g09820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCAGCAGAGGGGCTAAACAGAGAGCAGTACGTGTACTTGGCGAAGCTGTCGGAGCAGGCGGAGCGGTACGAGGAGATGGTGGAGTTCATGCAGAAGGTGGTGGTGGGGTCGACGCCGGCGTCGGAGCTCACGGTGGAGGAGCGCAACCTCCTCTCGGTGGCCTACAAGAACGTCATCGGCTCGCTGCGTGCCGCGTGGCGCATCGTCTCCTCCATCGAGCAGAAGGAGGAGGGCCGCAAGAACGACGACCACGTCTCCCTCGTCAAGCACTACAGATCCAAGGTCGAGAACGAGCTCACTCAGGTCTGCGCCAGCATCCTCAGCCTCCTCGACTCCAACCTCGTACCCTCCGCCTCCGCCAGCGAGTCCAAGGTCTTCTACTTGAAGATGAAGGGCGATTACCACCGCTATCTCGCCGAGTTTAAGGTTGGGGACGAAAGAAAAACCGCTACTGAGGATACCATGTTGTCTTACAAGGCTGCCCAGGATATTGCTTCTGCGGATCTTCCCCCTACTCACCCCATCAGATTGGGTCTTGCTCTCAACTTCTCCGTCTTCTACTATGAAATCCTCAACCAGTCTGATAAAGCGTGTGCCATGGCTAAACAGGCTTTTGAGGAAGCAATTGCTGAGCTGGACACCTTGGGAGAAGAATCTTACAAAGACAGCACGCTCATAATGCAGCTTTTAAGAGACAACCTCACCCTTTGGACTTCTGATGTTCAGGACCAGCTAGATGAGCCCTGA

>Glyma04g09820.1   sequence type=predicted peptide   gene model=Glyma04g09820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAAEGLNREQYVYLAKLSEQAERYEEMVEFMQKVVVGSTPASELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNDDHVSLVKHYRSKVENELTQVCASILSLLDSNLVPSASASESKVFYLKMKGDYHRYLAEFKVGDERKTATEDTMLSYKAAQDIASADLPPTHPIRLGLALNFSVFYYEILNQSDKACAMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDVQDQLDEP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo