Report for Sequence Feature Glyma04g09740
Feature Type: gene_model
Chromosome: Gm04
Start: 8031416
stop: 8033828
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g09740
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G09750 AT
Annotation by Michelle Graham. TAIR10: Eukaryotic aspartyl protease family protein | chr1:3157541-3158960 FORWARD LENGTH=449
SoyBase E_val: 0 ISS
GO:0006508 GO-bp
Annotation by Michelle Graham. GO Biological Process: proteolysis
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0009505 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall
SoyBase N/A ISS
GO:0048046 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: apoplast
SoyBase N/A ISS
GO:0004190 GO-mf
Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity
SoyBase N/A ISS
KOG1339
KOG
Aspartyl protease
JGI ISS
PTHR13683 Panther
ASPARTYL PROTEASES
JGI ISS
PTHR13683:SF98 Panther
CHLOROPLAST NUCLEIOD DNA-BINDING-RELATED
JGI ISS
PF00026 PFAM
Eukaryotic aspartyl protease
JGI ISS
UniRef100_G7J557 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Aspartic proteinase nepenthesin-1 n=1 Tax=Medicago truncatula RepID=G7J557_MEDTR
SoyBase E_val: 0 ISS
UniRef100_UPI000189D3E3 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000189D3E3 related cluster n=1 Tax=unknown RepID=UPI000189D3E3
SoyBase E_val: 0 ISS
Expression Patterns of Glyma04g09740
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g09740
Paralog Evidence Comments
Glyma06g09830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g09740 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g091800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g09740
Coding sequences of Glyma04g09740
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g09740.1 sequence type=CDS gene model=Glyma04g09740 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGGCTAAGTTGGCCACCACCATAATACTTATTTTCTCCGTAATTTGGCTTATGAGGGTGAATGGCATAGACCCTTGTGCCTCTCAAGCGGATAATTCCGACCTGAACGTGATTCCCATCTACAGCAAATGCTCACCGTTCAAACCACCAAAGTCAGACTCATCGTGGGACAACAGAATTATAAACATGGCCTCAAAAGACCCACTCCGATTCAAATACTTGTCCACCTTAGTGGGCCAAAAGACCGTGTCCACGGCCCCAATCGCTTCGGGCCAGACCTTCAACATCGGCAACTACGTCGTCAGGGTCAAATTGGGAACCCCTGGTCAACTTTTGTTCATGGTCCTCGACACCAGCACCGACGAGGCCTTCGTTCCATGCTCGGGCTGCACGGGCTGCTCCGACACCACTTTCTCGCCCAAAGCCTCCACCAGCTATGGCCCATTGGACTGCTCTGTTCCCCAGTGCGGTCAGGTCCGCGGGCTTTCGTGCCCCGCCACAGGTACCGGCGCGTGCTCCTTCAACCAATCCTACGCGGGCTCATCTTTCTCCGCCACCCTAGTCCAAGACTCGTTAAGATTAGCCACTGATGTTATCCCCAACTACTCCTTCGGCTGCGTCAACGCCATCACCGGCGCCTCTGTCCCGGCCCAAGGGCTTTTGGGCCTGGGCCGTGGCCCGCTGTCCTTGCTCTCCCAATCCGGGTCAAATTACTCGGGCATCTTCTCTTACTGTCTCCCCAGCTTCAAGTCCTACTACTTCTCTGGGTCGCTCAAGCTCGGGCCCGTGGGCCAGCCCAAGAGCATTCGCACCACCCCGCTTCTTCGCAGCCCTCACCGTCCTTCTCTTTACTACGTGAACTTCACCGGAATCAGCGTGGGACGTGTCCTGGTACCCTTTCCCAGCGAGTATCTTGGGTTTAACCCGAATACAGGATCCGGAACCATAATTGATTCGGGCACGGTTATAACCCGGTTCGTGGAGCCCGTTTACAACGCGGTGAGGGAGGAGTTCAGGAAGCAGGTGGGAGGCACTACATTCACGAGCATTGGAGCCTTCGATACGTGTTTTGTGAAAACCTACGAAACTCTGGCGCCGCCAATTACGCTGCACTTCGAGGGGTTGGACCTGAAACTGCCGTTGGAAAACAGCTTGATCCACAGCAGCGCGGGTTCGCTGGCGTGTCTTGCAATGGCGGCGGCACCCGACAATGTGAACTCGGTGTTGAACGTCATCGCCAACTTTCAGCAACAGAACCTTAGGATTTTGTTTGATACCGTCAATAATAAGGTTGGCATAGCCCGTGAGGTTTGTAACTAG
Predicted protein sequences of Glyma04g09740
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g09740.1 sequence type=predicted peptide gene model=Glyma04g09740 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEAKLATTIILIFSVIWLMRVNGIDPCASQADNSDLNVIPIYSKCSPFKPPKSDSSWDNRIINMASKDPLRFKYLSTLVGQKTVSTAPIASGQTFNIGNYVVRVKLGTPGQLLFMVLDTSTDEAFVPCSGCTGCSDTTFSPKASTSYGPLDCSVPQCGQVRGLSCPATGTGACSFNQSYAGSSFSATLVQDSLRLATDVIPNYSFGCVNAITGASVPAQGLLGLGRGPLSLLSQSGSNYSGIFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRSPHRPSLYYVNFTGISVGRVLVPFPSEYLGFNPNTGSGTIIDSGTVITRFVEPVYNAVREEFRKQVGGTTFTSIGAFDTCFVKTYETLAPPITLHFEGLDLKLPLENSLIHSSAGSLACLAMAAAPDNVNSVLNVIANFQQQNLRILFDTVNNKVGIAREVCN*