SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g09651

Feature Type:gene_model
Chromosome:Gm04
Start:7930633
stop:7932066
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09920AT Annotation by Michelle Graham. TAIR10: TRAF-type zinc finger-related | chr1:3224863-3226860 REVERSE LENGTH=192 SoyBaseE_val: 7.00E-31ISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_C6T0E3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6T0E3_SOYBN SoyBaseE_val: 2.00E-59ISS
UniRef100_G7J4M2UniRef Annotation by Michelle Graham. Most informative UniRef hit: TRAF-type zinc finger domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J4M2_MEDTR SoyBaseE_val: 5.00E-40ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g09651 not represented in the dataset

Glyma04g09651 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g09750 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g09651.1   sequence type=CDS   gene model=Glyma04g09651   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCACTTGTGAGTTCTGTGAGCTTCCTTTGCTGGCAATTGACCTGGCTGAGCATCAGGTTATATTAATCAAACTTTGTCACCTTTGTAACAAATATGTTAGACTGCGCGAACTATACAACCATGAAGATAGTTGCAATAGAATTCAAGACAATTCTGCAGGGTCTTCAAGGAATGAAATGTACGTGAGGCCAGTGGAAAGAGATGAGAGTGCTCGAAGAAGGCCGCAGAATGATTTCTCAAGAAAACGTCTTTTGTTCACAATAGCAATAACTGGCATTGCAGTTATCCTCGGATCTATTTTTTTCCAGAGGAAGACAGATCTCAGCAATGTGCAATAA

>Glyma04g09651.1   sequence type=predicted peptide   gene model=Glyma04g09651   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTCEFCELPLLAIDLAEHQVILIKLCHLCNKYVRLRELYNHEDSCNRIQDNSAGSSRNEMYVRPVERDESARRRPQNDFSRKRLLFTIAITGIAVILGSIFFQRKTDLSNVQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo