Glyma04g09620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g09620

Feature Type:	gene_model
Chromosome:	Gm04
Start:	7901890
stop:	7907215
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g09620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G09930	AT	Annotation by Michelle Graham. TAIR10: oligopeptide transporter 2 \| chr1:3227490-3230043 REVERSE LENGTH=734	SoyBase	E_val: 2.00E-96	ISS
GO:0006857	GO-bp	Annotation by Michelle Graham. GO Biological Process: oligopeptide transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
PTHR22601	Panther	ISP4 LIKE PROTEIN	JGI		ISS
PF03169	PFAM	OPT oligopeptide transporter protein	JGI		ISS
UniRef100_G7J4L5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Oligopeptide transporter n=1 Tax=Medicago truncatula RepID=G7J4L5_MEDTR	SoyBase	E_val: 2.00E-95	ISS
UniRef100_I1JV22	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JV22_SOYBN	SoyBase	E_val: 1.00E-131	ISS

Expression Patterns of Glyma04g09620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g09620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g090600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g09620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g09620

Limit To All Plant Sequences

>Glyma04g09620.1   sequence type=CDS   gene model=Glyma04g09620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCCATCGAGATGGAGAGTGCAAAAGAAGATGACATTTCGCCGATCGAGGAGGTTCGGCTGGTGGTGTCGAACGAAGACGATCCCAGGCAGCCGGTGTGGACGTTCCGCATGTGGTTCCTGGGAATCGTGGCGGTGATACTTCTCTCCTTCCTCAACACTTTCTTCGGCTACAGGAAGCAGCCACTCTTGGTCACCATGATTTCGGTTCAGGTGGCCACGCTTCCCATTGGCCGCTTCATGGCCAGGGTTCTCCCGCCAACCAAGTTTCGGATCCGAGGGAGGGACTTCTCGCTCAACCCTGGTCCCTTCAACATCAAGGAGCACGTCCTCATTTCCATATTCGCCAACGCCGGCGCCGCGTTTGGGAATGGCGCCGCTTATGCCGTCGGGATTGTCGATATAATCCGCGCCTTCTACGGCCGGAAGATTACCTTCCTGGCCGGTTGGCTCCTTGTTCTCACCACGCAGGTGTTGGGGTATGGATGGGCGGGGATAATGAAGAAGTACGTGGTGGAGCCCGCAGAGATGTGGTGGCCCTCCACTCTAGTGCAGGTCTCTTTGTTCAGGAAGAAGAGGAAAGACCTCTCATAA

Predicted protein sequences of Glyma04g09620

Limit To All Plant Sequences

>Glyma04g09620.1   sequence type=predicted peptide   gene model=Glyma04g09620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASIEMESAKEDDISPIEEVRLVVSNEDDPRQPVWTFRMWFLGIVAVILLSFLNTFFGYRKQPLLVTMISVQVATLPIGRFMARVLPPTKFRIRGRDFSLNPGPFNIKEHVLISIFANAGAAFGNGAAYAVGIVDIIRAFYGRKITFLAGWLLVLTTQVLGYGWAGIMKKYVVEPAEMWWPSTLVQVSLFRKKRKDLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain