Glyma04g09470 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g09470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g09470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g09470

Feature Type:	gene_model
Chromosome:	Gm04
Start:	7702662
stop:	7705229
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g09470

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G27600	AT	Annotation by Michelle Graham. TAIR10: Nucleotide-diphospho-sugar transferases superfamily protein \| chr1:9604083-9605881 REVERSE LENGTH=394	SoyBase	E_val: 1.00E-81	ISS
GO:0006486	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein glycosylation	SoyBase	N/A	ISS
GO:0009834	GO-bp	Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis	SoyBase	N/A	ISS
GO:0010417	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan biosynthetic process	SoyBase	N/A	ISS
GO:0010584	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen exine formation	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0015018	GO-mf	Annotation by Michelle Graham. GO Molecular Function: galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0042285	GO-mf	Annotation by Michelle Graham. GO Molecular Function: xylosyltransferase activity	SoyBase	N/A	ISS
PTHR10896	Panther	BETA-1,3-GLUCURONYLTRANSFERASE	JGI		ISS
PTHR10896:SF1	Panther	BETA-1,3-GLUCURONYLTRANSFERASE-RELATED	JGI		ISS
PF03360	PFAM	Glycosyltransferase family 43	JGI		ISS
UniRef100_Q50HW4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Beta-1,3-glucuronosyltransferase n=1 Tax=Medicago truncatula RepID=Q50HW4_MEDTR	SoyBase	E_val: 4.00E-88	ISS
UniRef100_UPI0002339F2D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339F2D related cluster n=1 Tax=unknown RepID=UPI0002339F2D	SoyBase	E_val: 7.00E-147	ISS

Expression Patterns of Glyma04g09470

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g09470 not represented in the dataset	Glyma04g09470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g09470 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g089300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g09470

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g09470

Limit To All Plant Sequences

>Glyma04g09470.2   sequence type=CDS   gene model=Glyma04g09470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCTTTTCGACGGACTCTGTCGCCGGCGTATCCCGATCGCCAGTACCTTAACGGTTCGTTTTCAGTCTCCTCCCCGTCGCACAAGCTTCCGTCCTCAAACGCAAAGTACTCCTCGCCGCTGCCGGAGCTTGTGGCGGCGTTCCTTCGCCTCGCCGGCGGGGTGTTCACGCGCCGGCACGGTCGGAAGGGGCAGTGGAGGCGCGTGGTGGTCAGGTGCGTGCTGTGCTTCTTCGTTGGGTTCTTGCTAGGCATGTTCCCGTTCGGCCACGTCCGCTTTGGCACTTGGCCTGTTGCCATGCTTGCGCCAAGCAAAAACAAGGCCATTTTGGAGGGTCCTGTATGCAATGCAAGCCAAGTGATTGGATGGCATACAAATGAGAAAAGTAAAAGACTTCGTAGATTCCATGTTGATATGTCTGGATTTGCATTCAACAGCACAATCTTGTGGGATCCAAAACGATGGCGACGCCCTTCTTCAAATCCCGTACGACAGTTAGACACAGTGAAGGAGGGTTTTCAAGAGACCACCTTTATAGAACAATTGGTGGAAGATGAAAGTCAAATGGAAGGTTCACCTCCTGGTTGTTCAAAAATATTGAATTGGCATCTCCATTTGGCTGCTAATAATATAGTTTACCCAAAAGGTTGGGTGCTTCAGAAAAACCTAGATGCTGTCATACCTGTCAAGTAA

Predicted protein sequences of Glyma04g09470

Limit To All Plant Sequences

>Glyma04g09470.2   sequence type=predicted peptide   gene model=Glyma04g09470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASFRRTLSPAYPDRQYLNGSFSVSSPSHKLPSSNAKYSSPLPELVAAFLRLAGGVFTRRHGRKGQWRRVVVRCVLCFFVGFLLGMFPFGHVRFGTWPVAMLAPSKNKAILEGPVCNASQVIGWHTNEKSKRLRRFHVDMSGFAFNSTILWDPKRWRRPSSNPVRQLDTVKEGFQETTFIEQLVEDESQMEGSPPGCSKILNWHLHLAANNIVYPKGWVLQKNLDAVIPVK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain