SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g09470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g09470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g09470

Feature Type:gene_model
Chromosome:Gm04
Start:7702662
stop:7705229
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27600AT Annotation by Michelle Graham. TAIR10: Nucleotide-diphospho-sugar transferases superfamily protein | chr1:9604083-9605881 REVERSE LENGTH=394 SoyBaseE_val: 1.00E-81ISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0009834GO-bp Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis SoyBaseN/AISS
GO:0010417GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan biosynthetic process SoyBaseN/AISS
GO:0010584GO-bp Annotation by Michelle Graham. GO Biological Process: pollen exine formation SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015018GO-mf Annotation by Michelle Graham. GO Molecular Function: galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:0042285GO-mf Annotation by Michelle Graham. GO Molecular Function: xylosyltransferase activity SoyBaseN/AISS
PTHR10896Panther BETA-1,3-GLUCURONYLTRANSFERASE JGI ISS
PTHR10896:SF1Panther BETA-1,3-GLUCURONYLTRANSFERASE-RELATED JGI ISS
PF03360PFAM Glycosyltransferase family 43 JGI ISS
UniRef100_Q50HW4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-1,3-glucuronosyltransferase n=1 Tax=Medicago truncatula RepID=Q50HW4_MEDTR SoyBaseE_val: 4.00E-88ISS
UniRef100_UPI0002339F2DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339F2D related cluster n=1 Tax=unknown RepID=UPI0002339F2D SoyBaseE_val: 7.00E-147ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g09470 not represented in the dataset

Glyma04g09470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g089300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g09470.2   sequence type=CDS   gene model=Glyma04g09470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCTTTTCGACGGACTCTGTCGCCGGCGTATCCCGATCGCCAGTACCTTAACGGTTCGTTTTCAGTCTCCTCCCCGTCGCACAAGCTTCCGTCCTCAAACGCAAAGTACTCCTCGCCGCTGCCGGAGCTTGTGGCGGCGTTCCTTCGCCTCGCCGGCGGGGTGTTCACGCGCCGGCACGGTCGGAAGGGGCAGTGGAGGCGCGTGGTGGTCAGGTGCGTGCTGTGCTTCTTCGTTGGGTTCTTGCTAGGCATGTTCCCGTTCGGCCACGTCCGCTTTGGCACTTGGCCTGTTGCCATGCTTGCGCCAAGCAAAAACAAGGCCATTTTGGAGGGTCCTGTATGCAATGCAAGCCAAGTGATTGGATGGCATACAAATGAGAAAAGTAAAAGACTTCGTAGATTCCATGTTGATATGTCTGGATTTGCATTCAACAGCACAATCTTGTGGGATCCAAAACGATGGCGACGCCCTTCTTCAAATCCCGTACGACAGTTAGACACAGTGAAGGAGGGTTTTCAAGAGACCACCTTTATAGAACAATTGGTGGAAGATGAAAGTCAAATGGAAGGTTCACCTCCTGGTTGTTCAAAAATATTGAATTGGCATCTCCATTTGGCTGCTAATAATATAGTTTACCCAAAAGGTTGGGTGCTTCAGAAAAACCTAGATGCTGTCATACCTGTCAAGTAA

>Glyma04g09470.2   sequence type=predicted peptide   gene model=Glyma04g09470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASFRRTLSPAYPDRQYLNGSFSVSSPSHKLPSSNAKYSSPLPELVAAFLRLAGGVFTRRHGRKGQWRRVVVRCVLCFFVGFLLGMFPFGHVRFGTWPVAMLAPSKNKAILEGPVCNASQVIGWHTNEKSKRLRRFHVDMSGFAFNSTILWDPKRWRRPSSNPVRQLDTVKEGFQETTFIEQLVEDESQMEGSPPGCSKILNWHLHLAANNIVYPKGWVLQKNLDAVIPVK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo