SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g09450

Feature Type:gene_model
Chromosome:Gm04
Start:7671470
stop:7672948
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g09450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G14530AT Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein | chr5:4684782-4686865 REVERSE LENGTH=330 SoyBaseE_val: 8.00E-15ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
UniRef100_B9S638UniRef Annotation by Michelle Graham. Most informative UniRef hit: COMPASS component SWD2, putative n=1 Tax=Ricinus communis RepID=B9S638_RICCO SoyBaseE_val: 2.00E-14ISS
UniRef100_I1MLV4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MLV4_SOYBN SoyBaseE_val: 2.00E-21ISS

Expression Patterns of Glyma04g09450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g09450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g089100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g09450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g09450
>Glyma04g09450.1   sequence type=CDS   gene model=Glyma04g09450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAACGGCGTCGCTTACGGAGCTTGATAACGATTTGGTTCAAAGCATGTCCATAGGAGTCGCATTTCTTCTTGTTAAGGGAAAAAGAAAATTTTGTTGGATGATACATTCGATTGATTTACATCAAAAGGATGTTTTATTTTTATCACTTTTCATGAGAAACACGGTACTGATCGTATATGTTGTACTCATCATCCAAGCTCTGTTATATGCTCTTCAAAGGAGAGTTTTTTCTCTCTGCATGTCTCCAATCAATGATAGCTTCATGTCTGGTTCTCTAGACCACAATGTTAGGATATGGGATCTTTGGGTAAATGCTTGTCATGTTGGTTGTTTTCATTTCTTTCTTTTTTATTAG
Predicted protein sequences of Glyma04g09450
>Glyma04g09450.1   sequence type=predicted peptide   gene model=Glyma04g09450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTTASLTELDNDLVQSMSIGVAFLLVKGKRKFCWMIHSIDLHQKDVLFLSLFMRNTVLIVYVVLIIQALLYALQRRVFSLCMSPINDSFMSGSLDHNVRIWDLWVNACHVGCFHFFLFY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo