SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g09200

Feature Type:gene_model
Chromosome:Gm04
Start:7353082
stop:7357579
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g09200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G21600AT Annotation by Michelle Graham. TAIR10: plastid transcriptionally active 6 | chr1:7571514-7573782 REVERSE LENGTH=328 SoyBaseE_val: 2.00E-151ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006417GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of translation SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009295GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleoid SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009508GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid chromosome SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_E6NU80UniRef Annotation by Michelle Graham. Most informative UniRef hit: JMS09K11.8 protein n=1 Tax=Jatropha curcas RepID=E6NU80_9ROSI SoyBaseE_val: 2.00E-161ISS
UniRef100_I1JUY9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUY9_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma04g09200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g09200 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g087000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g09200
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g09200
>Glyma04g09200.1   sequence type=CDS   gene model=Glyma04g09200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGACTACTGCTCCCACTACCTCTACTTTCTTCTTCCTCCTCTCTTCTCTCAATCCCCACCCACCTCGCTCCTTCTTCAGACACAAACCACTCTTTAACAACCCCTCCCTTCTCCTGCGCCCTCCTTTGAGGTCTCCTCGACACTTAACCCGCGCCGACGATGACGACGGCGACGGCGGCGGCCCCGACCACTACGAGATGGACGAGGACGAAATGGAGGAGCTCGACAACAAGAAGGACTTTGACATCGAGTACGACCCCCTCGTCCCCGCCGCCGCCGCCGCCGCCGCCGCCTCCGCCGCTGATGACAACATCGCCTTCGTCGAGAGCAAGAGCTTCGTGTCCACGCAGGGCTGGGACTCCGACACAGTCCTCGACTACAAAATCAACGAGGACGAGTTCCACAAGATCTGCCTGGTCGATTGCGACTTCTTCATTCGCAAGCCCCCCGACCCCGACAACGATGTCTACGATTTCAGAGAGATGTATGTTACTCCTCCGGATACAGATGTTTATTCAATTCCCAAGGTTCTCGCTCCAATGCCGCAGAAGTACATTAGATGTGCGCAGAGTGATTATGGAAGCTACAATGTGACAGAGCCACCTATTGATGCGCCTCGAGATCCTCTGTATAAAACTGAGAGGGAGATCCTCAAGGTGTACTTGACAAAACACTACAAAAATCGAAGGAAGGGTGATCCTGAGTTTGTTCTTGATTTTGAAGAGATTTATGTTGTTGATTCCAAAACCAAGTCAATTACCAGAGCCAAAGTTTTGGTAACAGCTCCTGGAGGGAGAACAAGAGATAGAAGGAGTGACTTGCTTGTTATATCTGATCGTGGGAGCTCCTTCAAAATAATACATGCGAGTGAAAAAGAGGATCCAACGACTGTCATAGAAAAACAAGAGTGGGAGAATAGCAGAGAAGAAATGGAGAGACATCTTAGAAAGCTAAGAGACTTCAGCATTTCAAATTGGTTTTGA
Predicted protein sequences of Glyma04g09200
>Glyma04g09200.1   sequence type=predicted peptide   gene model=Glyma04g09200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMTTAPTTSTFFFLLSSLNPHPPRSFFRHKPLFNNPSLLLRPPLRSPRHLTRADDDDGDGGGPDHYEMDEDEMEELDNKKDFDIEYDPLVPAAAAAAAASAADDNIAFVESKSFVSTQGWDSDTVLDYKINEDEFHKICLVDCDFFIRKPPDPDNDVYDFREMYVTPPDTDVYSIPKVLAPMPQKYIRCAQSDYGSYNVTEPPIDAPRDPLYKTEREILKVYLTKHYKNRRKGDPEFVLDFEEIYVVDSKTKSITRAKVLVTAPGGRTRDRRSDLLVISDRGSSFKIIHASEKEDPTTVIEKQEWENSREEMERHLRKLRDFSISNWF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo