SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g09060

Feature Type:gene_model
Chromosome:Gm04
Start:7228446
stop:7229424
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g09060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32860AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 46 Blast hits to 46 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 46; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:15856710-15857309 REVERSE LENGTH=199 SoyBaseE_val: 9.00E-22ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009691GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JUX0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUX0_SOYBN SoyBaseE_val: 6.00E-127ISS
UniRef100_Q9FQZ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Avr9/Cf-9 rapidly elicited protein 146 n=1 Tax=Nicotiana tabacum RepID=Q9FQZ6_TOBAC SoyBaseE_val: 5.00E-15ISS

Expression Patterns of Glyma04g09060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g09060
ParalogEvidenceComments
Glyma06g09180 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g09060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g085800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g09060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g09060
>Glyma04g09060.2   sequence type=CDS   gene model=Glyma04g09060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAAACAAAGCAGAGACACGCACTTCCCTCTGCCACAACATGTGACAGACATAACGTGCATGGACCCGAACCGGCCACCACTCGTGGCGGAGAAGGTCTTCAAAACGGTGCGTTTCATAGGCTTCTTCCTACAAAACGGCGTTTCGAAGAGCAAGGTGTTTCATGATGTGCAGGACGTGATGAAGCGTGGGAAGAACATAGGGAAGGCGCTGAACGACATCGTGGCTCGCCACCACCAGGCGCTGACGTGTCGCCCACGCGACGCGCACGTGGCCTTCGTGTCGCCTCTGGAGTACCAGTTCAGCTGCAGCGGGAGTCCGCCGCGCACTTCGCATGCCGGCCGGAGGAAGCTCTCTCCGGCCTCCGCCGCTGTTCGCCGATCTCCGGGGCACCGTGCAGTGAGGATGTGCCGTGGCGGTGGTGCCGCCGACGGCACGATAGAGAGGCGCGTGAAGATCACGGACTCCGTTGCTTCCATGTTCAACGACACCGCGGAGAAGGATTTTCACGTGGACGAGGCCGCGGAGGAGTTCATAGCGAGGTTTTACAGAGATTTGAGGTTGCAGAAATGGCTGGATCACTATTGCTGA
Predicted protein sequences of Glyma04g09060
>Glyma04g09060.2   sequence type=predicted peptide   gene model=Glyma04g09060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMKQSRDTHFPLPQHVTDITCMDPNRPPLVAEKVFKTVRFIGFFLQNGVSKSKVFHDVQDVMKRGKNIGKALNDIVARHHQALTCRPRDAHVAFVSPLEYQFSCSGSPPRTSHAGRRKLSPASAAVRRSPGHRAVRMCRGGGAADGTIERRVKITDSVASMFNDTAEKDFHVDEAAEEFIARFYRDLRLQKWLDHYC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo