Report for Sequence Feature Glyma04g08960
Feature Type: gene_model
Chromosome: Gm04
Start: 7095951
stop: 7098309
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g08960
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G32900 AT
Annotation by Michelle Graham. TAIR10: Peptidyl-tRNA hydrolase II (PTH2) family protein | chr4:15879542-15880979 REVERSE LENGTH=140
SoyBase E_val: 6.00E-28 ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0004045 GO-mf
Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA hydrolase activity
SoyBase N/A ISS
PTHR12649 Panther
PEPTIDYL-TRNA HYDROLASE 2
JGI ISS
PTHR12649:SF6 Panther
UNCHARACTERIZED
JGI ISS
PF01981 PFAM
Peptidyl-tRNA hydrolase PTH2
JGI ISS
UniRef100_G7J3G4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-tRNA hydrolase n=1 Tax=Medicago truncatula RepID=G7J3G4_MEDTR
SoyBase E_val: 3.00E-41 ISS
UniRef100_I1JUW1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JUW1_SOYBN
SoyBase E_val: 2.00E-62 ISS
Expression Patterns of Glyma04g08960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g08960
Paralog Evidence Comments
Glyma06g09050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g08960 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g084600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g08960
Coding sequences of Glyma04g08960
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g08960.2 sequence type=CDS gene model=Glyma04g08960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTCCTTTCCGTCCTAAATACTAATCAATCTCGCGACCAGCAACAACAAAAGCAAAAAGGAGAATGGTTAGCAGGAAGTTTCAAGGCTGAGAACTTCATTCCAGGGCTTGTTATAGGTTTCATTTTTGGTCTGTTGTTGGATTTATCAAAGCCCAGTAGAAATCACTTGTCCAAGAAAATGTTCTCATCTGCCAAACCTCAACAACAGCAACTCGCAGTCTCAAGCAATGGTGATCAAGAACTTAAAATGGTTCTGGTTGTTCGGCAAGACCTAAAGATGAAATCCGGAAAGATTGCATCTCAATGTGCTCATAAGATATGCAATTATTGTTAA
Predicted protein sequences of Glyma04g08960
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g08960.2 sequence type=predicted peptide gene model=Glyma04g08960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MFLSVLNTNQSRDQQQQKQKGEWLAGSFKAENFIPGLVIGFIFGLLLDLSKPSRNHLSKKMFSSAKPQQQQLAVSSNGDQELKMVLVVRQDLKMKSGKIASQCAHKICNYC*