Glyma04g08740 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g08740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g08740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g08740

Feature Type:	gene_model
Chromosome:	Gm04
Start:	6869397
stop:	6870181
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g08740

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32770	AT	Annotation by Michelle Graham. TAIR10: tocopherol cyclase, chloroplast / vitamin E deficient 1 (VTE1) / sucrose export defective 1 (SXD1) \| chr4:15804981-15807790 FORWARD LENGTH=488	SoyBase	E_val: 6.00E-64	ISS
GO:0006631	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid metabolic process	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0009266	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009915	GO-bp	Annotation by Michelle Graham. GO Biological Process: phloem sucrose loading	SoyBase	N/A	ISS
GO:0010189	GO-bp	Annotation by Michelle Graham. GO Biological Process: vitamin E biosynthetic process	SoyBase	N/A	ISS
GO:0010264	GO-bp	Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process	SoyBase	N/A	ISS
GO:0015994	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process	SoyBase	N/A	ISS
GO:0016122	GO-bp	Annotation by Michelle Graham. GO Biological Process: xanthophyll metabolic process	SoyBase	N/A	ISS
GO:0031347	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of defense response	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009706	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0010287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule	SoyBase	N/A	ISS
GO:0009976	GO-mf	Annotation by Michelle Graham. GO Molecular Function: tocopherol cyclase activity	SoyBase	N/A	ISS
UniRef100_B2ZSX9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Tocopherol cyclase n=1 Tax=Phaseolus vulgaris RepID=B2ZSX9_PHAVU	SoyBase	E_val: 2.00E-83	ISS
UniRef100_UPI00023394E4	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023394E4 related cluster n=1 Tax=unknown RepID=UPI00023394E4	SoyBase	E_val: 9.00E-89	ISS

Expression Patterns of Glyma04g08740

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g08740 not represented in the dataset	Glyma04g08740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g08740 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g082300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g08740

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g08740

Limit To All Plant Sequences

>Glyma04g08740.1   sequence type=CDS   gene model=Glyma04g08740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGCCAAGCTCTGGAACTGGAACCCTCTCCTTCTTCCTCCTCGTTTTTCTTCACTCAAACATGCTTTTCCATCAACAACTACTCGCCTCGTAGCTCACAATTCAGTCTCAGAAACCGTTCCCATTCATAAGGAAAAGGAACAAACCCTACCTTCTGTCAAACCTACTTACTCCCCCACTCCTCCCAATCGAGGCCTTCGAACCCCTCACAGCGGGTACCATTTTGATGGGACTACTCGCAAATTCTTCGAGGGTTGGTACTTCAAAGTCTCCATTCCCGAACGGAAGCAGAGCTTTTGCTTTATGTATACCGTCGAGAGTCCCCTGTTTCGTAAACCATTGACGCAGCTCGAACTGGCCCAATACGGGCCCAGGTTTACTGGTGTCGGGGCCCAAATTCTCGGTGCTGATGACAAATATGTTTGCCAACACTCTCCCCAATCACATTTTTTCTGGGGAAGCAGGCATGAACTAATGTTGGGGAACACGTTCGAGCCCAACCAAAATTCTAAACCTCCAAACAAGGAGGTTCCTCCTCAGGTTTTTATTCCATCTTTCAATCTTATATGTTGGAAAATATCAGGGGATAAACCCTTAGGAGATCTATAA

Predicted protein sequences of Glyma04g08740

Limit To All Plant Sequences

>Glyma04g08740.1   sequence type=predicted peptide   gene model=Glyma04g08740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAKLWNWNPLLLPPRFSSLKHAFPSTTTRLVAHNSVSETVPIHKEKEQTLPSVKPTYSPTPPNRGLRTPHSGYHFDGTTRKFFEGWYFKVSIPERKQSFCFMYTVESPLFRKPLTQLELAQYGPRFTGVGAQILGADDKYVCQHSPQSHFFWGSRHELMLGNTFEPNQNSKPPNKEVPPQVFIPSFNLICWKISGDKPLGDL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain