Glyma04g08590 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g08590

Feature Type:	gene_model
Chromosome:	Gm04
Start:	6731681
stop:	6733241
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g08590

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G57850	AT	Annotation by Michelle Graham. TAIR10: D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein \| chr5:23435548-23437287 REVERSE LENGTH=373	SoyBase	E_val: 5.00E-60	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0008153	GO-bp	Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid biosynthetic process	SoyBase	N/A	ISS
GO:0046654	GO-bp	Annotation by Michelle Graham. GO Biological Process: tetrahydrofolate biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0008696	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 4-amino-4-deoxychorismate lyase activity	SoyBase	N/A	ISS
PTHR11825	Panther	SUBGROUP IIII AMINOTRANSFERASE	JGI		ISS
PTHR11825:SF6	Panther	BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE RELATED	JGI		ISS
PF01063	PFAM	Aminotransferase class IV	JGI		ISS
UniRef100_B9RS41	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: D-alanine aminotransferase, putative n=1 Tax=Ricinus communis RepID=B9RS41_RICCO	SoyBase	E_val: 3.00E-76	ISS
UniRef100_I1JUS9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUS9_SOYBN	SoyBase	E_val: 6.00E-174	ISS

Expression Patterns of Glyma04g08590

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g08590

Paralog	Evidence	Comments
Glyma06g08700	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g08590 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g081000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g08590

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g08590

Limit To All Plant Sequences

>Glyma04g08590.2   sequence type=CDS   gene model=Glyma04g08590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAACTAAAATCATTCAGAGAAAAGGTAAAGGGCAAGCAGCAATTCCTTGCTATGTATTCTAGCATTTTTGGTGGGATAACAACAGACCCTGCCGCTATGGTTATTCCCATAGATGACCACATGGTCCACAGCCCACAGGGACCATGGATGAATATCCCTACGCCAAAGCCTAACGCCATCCTCAAATATGATATAGCCAGATACCCCATCTGGTACATGACTCGCAAATTGTTTTCGCCAAATAAACTTCGAATAACAATAAGGATCAGCATCCACGGCCAAAATAAACCCCCATATGATCGTGGAACCACACGAAGAATACTTATCCAAACCGACCAGGAGATTTCGACCTATCTCCCTCTGGCTGCCATCCAATCATGTCTTTACGCAATCGCAATACGTGATCCGTCACCAATCAACTTTATGGGAGTTAAAGTTGTGACCTCAAATGTTCCCATTAAGCCTCAGTTTGCAACCACCAAGAGTGTGAATTATCTTCCGAACGTTGGTGCGTTTGTGGCCATTTGGTTTGATAGTGATGGGTTTGTTGCTGAAGGGCCTAGCATGAACGTGGCTTTTGTCTCCAAGGAGAATGAGTTTGTGATGCCTCTACGTGACAACATTCTAAGTGGCTGCACGGCTAAGAGAGTTTTAACCCTTGCCGAGTCTTTGGTTAAAGAGGGTAAGCTTTGTGGGATAAGAATGAAAAATGTGAACGTGGAGGAAGGGAAAAAATGCAGATGA

Predicted protein sequences of Glyma04g08590

Limit To All Plant Sequences

>Glyma04g08590.2   sequence type=predicted peptide   gene model=Glyma04g08590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKLKSFREKVKGKQQFLAMYSSIFGGITTDPAAMVIPIDDHMVHSPQGPWMNIPTPKPNAILKYDIARYPIWYMTRKLFSPNKLRITIRISIHGQNKPPYDRGTTRRILIQTDQEISTYLPLAAIQSCLYAIAIRDPSPINFMGVKVVTSNVPIKPQFATTKSVNYLPNVGAFVAIWFDSDGFVAEGPSMNVAFVSKENEFVMPLRDNILSGCTAKRVLTLAESLVKEGKLCGIRMKNVNVEEGKKCR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain