SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g08560

Feature Type:gene_model
Chromosome:Gm04
Start:6707043
stop:6712097
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g08560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11520AT Annotation by Michelle Graham. TAIR10: aspartate aminotransferase 3 | chr5:3685257-3687721 REVERSE LENGTH=449 SoyBaseE_val: 0ISS
GO:0006520GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid metabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006807GO-bp Annotation by Michelle Graham. GO Biological Process: nitrogen compound metabolic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004069GO-mf Annotation by Michelle Graham. GO Molecular Function: L-aspartate:2-oxoglutarate aminotransferase activity SoyBaseN/AISS
GO:0008483GO-mf Annotation by Michelle Graham. GO Molecular Function: transaminase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0030170GO-mf Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding SoyBaseN/AISS
KOG1411 KOG Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 JGI ISS
PTHR11879Panther ASPARTATE AMINOTRANSFERASE JGI ISS
PF00155PFAM Aminotransferase class I and II JGI ISS
UniRef100_I1JUS6UniRef Annotation by Michelle Graham. Best UniRef hit: Aspartate aminotransferase n=1 Tax=Glycine max RepID=I1JUS6_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1JUS6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aspartate aminotransferase n=1 Tax=Glycine max RepID=I1JUS6_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma04g08560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g08560
ParalogEvidenceComments
Glyma06g08670 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g08560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g080700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g08560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g08560
>Glyma04g08560.1   sequence type=CDS   gene model=Glyma04g08560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTCACGACGGCATCTCCGCTGCTTCTTCAGATTCCGTCTTCAATCACCTCGTTCGTGCTCCCGAAGATCCTATCCTCGGGGTAACTGTTGCTTATAACAAAGATCCAAGTCCAGTTAAGCTCAACTTGGGAGTTGGTGCTTACCGAACTGAGGAAGGAAAACCTCTTGTTTTGAATGTAGTGAGGCGAGTTGAGCAGCAACTCATAAATGACGTGTCACGCAACAAGGAATATATTCCGATTGTTGGGCTAGCTGATTTTAATAAATTGAGTGCTAAGCTCATTTTTGGGGCTGACAGCCCTGCTATTCAAGACAACAGGGTTACCACTGTTCAATGCTTGTCTGGAACTGGTTCATTAAGAGTTGGGGGTGAATTTTTGGCTAAACACTATCACCAACGGACTATATACTTGCCAACACCAACTTGGGGTAATCACCCAAAGGTTTTCAACTTAGCAGGGTTGTCTGTCAAAACATATCGCTACTATGCTCCAGCAACACGAGGGCTTGATTTTCAAGGACTTCTAGAAGATCTTGGTTCTGCTCCATCTGGATCTATTGTTTTGCTACATGCATGCGCACATAACCCCACTGGTGTGGATCCAACCCTTGAGCAATGGGAGCAGATTAGGCTGCTAATAAGATCAAAAGCTTTGTTACCTTTCTTTGACAGTGCTTATCAGGGTTTTGCTAGCGGAAGTCTAGATGCAGATGCCCAGCCTGTTCGTTTGTTTGTTGCTGATGGGGGTGAATTGCTGGTGGCACAAAGCTATGCAAAGAATCTGGGTCTTTATGGGGAACGTGTTGGCGCCTTAAGCATTGTCTGCAAGTCAGCTGATGTTGCAAGCAGGGTCGAGAGCCAGCTGAAACTAGTGATTAGGCCCATGTACTCAAGTCCTCCTATTCATGGTGCATCCATTGTGGCTGCCATTCTCAAGGACCGGGATTTGTTCAATGACTGGACTATTGAGTTGAAGGCAATGGCTGATCGCATCATCAATATGCGCCAAGAACTTTTCGATGCTTTACGTTCCAGAGGCACACCTGGTGATTGGAGTCACATTATCAAGCAGATTGGAATGTTTACTTTCACTGGATTGAATGCGGAACAAGTTTCCTTCATGACTAAAGAGTACCATATATACATGACATCTGACGGGAGGATTAGCATGGCTGGTCTGAGTTCCAAAACTGTCCCACTTCTAGCGGATGCGATACATGCTGCTGTAGCTCGAGTTGCCTAA
Predicted protein sequences of Glyma04g08560
>Glyma04g08560.1   sequence type=predicted peptide   gene model=Glyma04g08560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASHDGISAASSDSVFNHLVRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRRVEQQLINDVSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQDNRVTTVQCLSGTGSLRVGGEFLAKHYHQRTIYLPTPTWGNHPKVFNLAGLSVKTYRYYAPATRGLDFQGLLEDLGSAPSGSIVLLHACAHNPTGVDPTLEQWEQIRLLIRSKALLPFFDSAYQGFASGSLDADAQPVRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVESQLKLVIRPMYSSPPIHGASIVAAILKDRDLFNDWTIELKAMADRIINMRQELFDALRSRGTPGDWSHIIKQIGMFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAGLSSKTVPLLADAIHAAVARVA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo