SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g08390

Feature Type:gene_model
Chromosome:Gm04
Start:6561244
stop:6562602
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g08390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G25735AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 31 Blast hits to 31 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 31; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:10975345-10975704 REVERSE LENGTH=119 SoyBaseE_val: 7.00E-11ISS
GO:0002237GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JUR0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUR0_SOYBN SoyBaseE_val: 3.00E-80ISS
UniRef100_Q8RUI1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q8RUI1_ARATH SoyBaseE_val: 3.00E-08ISS

Expression Patterns of Glyma04g08390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g08390
ParalogEvidenceComments
Glyma06g08505 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g08390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g079300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g08390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g08390
>Glyma04g08390.1   sequence type=CDS   gene model=Glyma04g08390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGTGAAGAAGTACTGGTTCGGTTCAAGAAGTCAAAGGACACAAAACATAAGGTTAGGTCGAAACTACACAAAACCCCACTATAGGAGCTATTCTCCAAGCAGCTGTGATGGCACAAAAACAACAGTGTGGCAGATGCTTTGGAGAAAGCTGAAAAGATCTTCAGATAAGAAGAAAGTGTTCAGTTCTCACACTACAATGGAGGGTGTCTATGATCAAGAAACATACTCAATGAACTTCGATCAAGGAACGGGATGGATGGAGCCAGACAATCTTCCTCGTTCCTTCTCAGCTCGGTTTGCTGATCCATCTAGGATCTTACCACCAAAACATTTATTGAGTTGA
Predicted protein sequences of Glyma04g08390
>Glyma04g08390.1   sequence type=predicted peptide   gene model=Glyma04g08390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVKKYWFGSRSQRTQNIRLGRNYTKPHYRSYSPSSCDGTKTTVWQMLWRKLKRSSDKKKVFSSHTTMEGVYDQETYSMNFDQGTGWMEPDNLPRSFSARFADPSRILPPKHLLS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo