SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g08330

Feature Type:gene_model
Chromosome:Gm04
Start:6533374
stop:6536171
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g08330
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G24840AT Annotation by Michelle Graham. TAIR10: tRNA (guanine-N-7) methyltransferase | chr5:8533897-8534652 REVERSE LENGTH=251 SoyBaseE_val: 4.00E-145ISS
GO:0006400GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA modification SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0015946GO-bp Annotation by Michelle Graham. GO Biological Process: methanol oxidation SoyBaseN/AISS
GO:0019415GO-bp Annotation by Michelle Graham. GO Biological Process: acetate biosynthetic process from carbon monoxide SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008176GO-mf Annotation by Michelle Graham. GO Molecular Function: tRNA (guanine-N7-)-methyltransferase activity SoyBaseN/AISS
KOG3115 KOG Methyltransferase-like protein JGI ISS
PTHR23417Panther 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE/TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE JGI ISS
PTHR23417:SF1Panther TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE JGI ISS
PF02390PFAM Putative methyltransferase JGI ISS
UniRef100_B9SUG0UniRef Annotation by Michelle Graham. Most informative UniRef hit: tRNA (Guanine-n(7)-)-methyltransferase, putative n=1 Tax=Ricinus communis RepID=B9SUG0_RICCO SoyBaseE_val: 1.00E-165ISS
UniRef100_I1JUQ6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUQ6_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma04g08330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g08330
ParalogEvidenceComments
Glyma06g08450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g08330 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g078700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g08330
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g08330
>Glyma04g08330.1   sequence type=CDS   gene model=Glyma04g08330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGAGACTGAGGTAAATCCAACTATCAGCAAGTCAACTGGATTGCCTCGAAAGCGCTTCTATCGAGCACGAGCACACAGCAATCCACTGAGTGACTCTCACTTCCCAGTGCCAATTTCACCCAGCCATGTTGACTATTCTCTCCATTACCCTCAGTTATTTCCCTTGTCTGGTCAAGCTGATAGTTCCAAAAAGATCCAGTTTGCTGATGTTGGTTGTGGTTTTGGAGGGCTGCTCATAAGTCTTTCCACTCTGTTCCCAGAAACATTGATGATTGGAATGGAACTTAGAGACAAAGTGACTGAGTACGTCAAGGAGCGAATTTCATCTTTAAGGGTAGCAAATCCTGGTCAATACCAAAATGTTTCTGTGGTGCGAACTAACTCCATGAAGTATATTCCTAATTACTTTGAGAAAGGAACGCTCTCAAAGATGTTTTTCTTGTTTCCTGATCCTCATTTTAAAGAGAAGAATCATCGCCGTAGGGTTATCAGTCCATTCTTGCTAGATGAGTATGCTTATGTTCTTGAGGTTGGTGGAATTATATACACAATATCAGACGTAGAAGAGCTTGGAGACTGGATGAAGTCTTGTCTGGAGAATCACCCTATGTTCGAAGCCTTGACTGAGAAAGAACTTGAAGCAGATCCAGTTGTGAAGCTTTTAAGTTCTGCTACTGAAGAAGGCCAAAAGGTTGCTAGAAATGAAGGACAAACTTTCCAGGCTGTATTCAGACGCATTGTACCATCTGATCAAGCATCCTAG
Predicted protein sequences of Glyma04g08330
>Glyma04g08330.1   sequence type=predicted peptide   gene model=Glyma04g08330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSETEVNPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQLFPLSGQADSSKKIQFADVGCGFGGLLISLSTLFPETLMIGMELRDKVTEYVKERISSLRVANPGQYQNVSVVRTNSMKYIPNYFEKGTLSKMFFLFPDPHFKEKNHRRRVISPFLLDEYAYVLEVGGIIYTISDVEELGDWMKSCLENHPMFEALTEKELEADPVVKLLSSATEEGQKVARNEGQTFQAVFRRIVPSDQAS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo