SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g08200

Feature Type:gene_model
Chromosome:Gm04
Start:6425211
stop:6429161
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g08200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31300AT Annotation by Michelle Graham. TAIR10: N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein | chr4:15188927-15190935 FORWARD LENGTH=233 SoyBaseE_val: 2.00E-150ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051603GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005839GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex SoyBaseN/AISS
GO:0004175GO-mf Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity SoyBaseN/AISS
GO:0004298GO-mf Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
KOG0174 KOG 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 JGI ISS
PTHR11599Panther PROTEASOME SUBUNIT ALPHA/BETA JGI ISS
PTHR11599:SF4Panther PROTEASOME BETA SUBUNIT JGI ISS
PF00227PFAM Proteasome subunit JGI ISS
UniRef100_I1K964UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit beta type n=1 Tax=Glycine max RepID=I1K964_SOYBN SoyBaseE_val: 4.00E-168ISS
UniRef100_UPI000151E3F5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000151E3F5 related cluster n=1 Tax=unknown RepID=UPI000151E3F5 SoyBaseE_val: 8.00E-171ISS

Expression Patterns of Glyma04g08200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g08200
ParalogEvidenceComments
Glyma06g08260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g08200 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g077400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g08200
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g08200
>Glyma04g08200.1   sequence type=CDS   gene model=Glyma04g08200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCAGAAGGTCGATTTCAGCGCTCCCCATTCCATGGGAACCACTATCATCGGCGTTACTTACAACGGCGGTGTCGTTCTCGGAGCCGACTCTCGAACCAGCACCGGAGTGTATGTTGCCAACCGAGCATCGGACAAAATCACTCAGCTCACTGATAATGTATACGTGTGTCGCTCTGGATCGGCTGCTGATTCTCAGATTGTCTCTGATTATGTGCGTTACTTCCTCCATCAACACACAATACAACTTGGACAACCTGCAACAGTTAAAGTTGCTGCAAACCTTGTCCGACTTCTCTCATATAACAATAAGAATTTCTTAGAGACCGGGTTAATTGTTGGTGGATGGGATAAATATGAAGGTGGACAAATTTATGGAGTTCCTCTGGGTGGAACAATAGTACAACAACCTTTTGCTATCGGAGGATCTGGCTCCAGTTACTTGTATGGTTTCTTTGACCAAGCCTGGAAAGAGGGAATGACCAAGGATGAAGCTGAGGATTTAGTAAAAAAGGCTGTTTCACTGGCTATTGCTCGTGATGGTGCAAGTGGTGGGGTTGTCCGAACAGTCATAATAAACTCAGAGGGAGTGACCAGGAATTTCTACCCTGGCGACCAACTTCCATTATGGCACGAGGAAATGGAGCCCCACAACTCCTTGCTAGACATTCTTGGTGCCCCAGAGCCGATGAGCATGTGA
Predicted protein sequences of Glyma04g08200
>Glyma04g08200.1   sequence type=predicted peptide   gene model=Glyma04g08200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDQKVDFSAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYVCRSGSAADSQIVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLETGLIVGGWDKYEGGQIYGVPLGGTIVQQPFAIGGSGSSYLYGFFDQAWKEGMTKDEAEDLVKKAVSLAIARDGASGGVVRTVIINSEGVTRNFYPGDQLPLWHEEMEPHNSLLDILGAPEPMSM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo