SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g08190

Feature Type:gene_model
Chromosome:Gm04
Start:6420371
stop:6422916
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g08190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31290AT Annotation by Michelle Graham. TAIR10: ChaC-like family protein | chr4:15186851-15188278 FORWARD LENGTH=227 SoyBaseE_val: 2.00E-115ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3182 KOG Predicted cation transporter JGI ISS
PTHR12192Panther CATION TRANSPORT PROTEIN CHAC-RELATED JGI ISS
PF04752PFAM ChaC-like protein JGI ISS
UniRef100_G7J2V4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cation transport regulator-like protein n=1 Tax=Medicago truncatula RepID=G7J2V4_MEDTR SoyBaseE_val: 3.00E-138ISS
UniRef100_I1JUP2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JUP2_SOYBN SoyBaseE_val: 6.00E-165ISS

Expression Patterns of Glyma04g08190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g08190
ParalogEvidenceComments
Glyma06g08250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g08190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g077300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g08190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g08190
>Glyma04g08190.1   sequence type=CDS   gene model=Glyma04g08190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTTCTGGGTTTTTGGCTACGGTTCACTGGTGTGGAACCCTGGATTCGATTACGACGAGAAGATTATTGGTTTCATCAAGGACTACAGACGCGTGTTTGATTTAGCGTGCATTGATCACCGGGGAACGCCTGAAAACCCAGCGAGAACTTGCACATTGGAGGAGAAAGAAGGGGCTATTTGCTGGGGAGCTGCTTATTGTGTTCGAGGAGGCCCTGAAAAGGAAAAATTGGCTATGCAGTATTTGGAGCGACGGGAATGTGAATATGACAGAAAGACTCTTGTAAACTTCTTCAAGGAAGGAGATTCACTGCATCCTACTTTAACTGATGTAATAGTATTCACATCTACTCCAGACAAAGTGAACAACAAATACTACCTGGGACCTGCTCCACTTGAAGACATGGCTAGGCAAATAGCAACTGCATACGGCCCTTGCGGAAACAACAGGGATTACATTTTCCTTCTAGAAAAGGCCATGCATGATATTGGCCATGAGGATGACTTGGTGATAGAGCTTGCCAATGAAGTGAAGAAAGTACTTGGAGTGGGAAATGTAGTACCAAAGGAGAAGAAACAGGTTGGAGCAGCACAACTTCCACACCCTCCTCATGTGCCAATCCCTACCCTTCAACTGCTCCCGCTGCCAGAACCTATTGCTTTGGATAGCTGA
Predicted protein sequences of Glyma04g08190
>Glyma04g08190.1   sequence type=predicted peptide   gene model=Glyma04g08190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVFWVFGYGSLVWNPGFDYDEKIIGFIKDYRRVFDLACIDHRGTPENPARTCTLEEKEGAICWGAAYCVRGGPEKEKLAMQYLERRECEYDRKTLVNFFKEGDSLHPTLTDVIVFTSTPDKVNNKYYLGPAPLEDMARQIATAYGPCGNNRDYIFLLEKAMHDIGHEDDLVIELANEVKKVLGVGNVVPKEKKQVGAAQLPHPPHVPIPTLQLLPLPEPIALDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo