Glyma04g08120 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g08120

Feature Type:	gene_model
Chromosome:	Gm04
Start:	6360564
stop:	6362275
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g08120

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G31600	AT	Annotation by Michelle Graham. TAIR10: UDP-N-acetylglucosamine (UAA) transporter family \| chr4:15315232-15316909 REVERSE LENGTH=323	SoyBase	E_val: 3.00E-89	ISS
GO:0015786	GO-bp	Annotation by Michelle Graham. GO Biological Process: UDP-glucose transport	SoyBase	N/A	ISS
GO:0048527	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root development	SoyBase	N/A	ISS
GO:0080147	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair cell development	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005459	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-galactose transmembrane transporter activity	SoyBase	N/A	ISS
GO:0005460	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-glucose transmembrane transporter activity	SoyBase	N/A	ISS
PTHR11132	Panther	SOLUTE CARRIER FAMILY 35	JGI		ISS
UniRef100_G7J2T9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: UDP-sugar transporter sqv-7 n=1 Tax=Medicago truncatula RepID=G7J2T9_MEDTR	SoyBase	E_val: 3.00E-95	ISS
UniRef100_UPI0002339C61	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339C61 related cluster n=1 Tax=unknown RepID=UPI0002339C61	SoyBase	E_val: 1.00E-123	ISS

Expression Patterns of Glyma04g08120

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g08120

Paralog	Evidence	Comments
Glyma06g08190	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g08120 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g08120

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g08120

Limit To All Plant Sequences

>Glyma04g08120.2   sequence type=CDS   gene model=Glyma04g08120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTGCTCTTTCAGTGATATTGACTGCTGCCGGAGTTCTCATTGCTGCCCTTGGAGATTTTTTCTCATGGCCTTTGTTTCCGTTTTTTTTCCAGACCATGTACCTTGTGCTGGTGGAAAAATCTGGTGCTGAGGACGGACTTTCATCCCTGGAAATCATGTTCTATAACAGCTTTTTATCTCTTCCATTTTTTATGTTTCTCATCATAGCCACTGGGGAACTCCCAAATTCTTTATCTGTATTATTTGCAAAGGTCAGAATCTTAACCTGTTATTCTTTTTCATTTTTGGTTATTCTTATTCTTGCGTTGGTGATGGGCATCGTTCTCAACTTCAACATGTTCTTATGCACAATAGTTAATTCAGCCTTAACTACTACAACTATTGTTGGCGTTCTCAAAGGGATTGTTTCCACGACCCTTGTTTTCTTCTTACTGGGTGGTGTTCAAGTCCATGCTTTGAATGTGTCTGGATTGGTTATCAATACAGCTGGTGGTGTGTGGTATTCATTTGCTAAATATCAGAAGAGAAAAAGTAAGGCGGTGAAGCTAGTAACAGAAGCGGAGGCTCATTGTAAATAG

Predicted protein sequences of Glyma04g08120

Limit To All Plant Sequences

>Glyma04g08120.2   sequence type=predicted peptide   gene model=Glyma04g08120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VALSVILTAAGVLIAALGDFFSWPLFPFFFQTMYLVLVEKSGAEDGLSSLEIMFYNSFLSLPFFMFLIIATGELPNSLSVLFAKVRILTCYSFSFLVILILALVMGIVLNFNMFLCTIVNSALTTTTIVGVLKGIVSTTLVFFLLGGVQVHALNVSGLVINTAGGVWYSFAKYQKRKSKAVKLVTEAEAHCK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain