Report for Sequence Feature Glyma04g07501
Feature Type: gene_model
Chromosome: Gm04
Start: 5850110
stop: 5852997
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g07501
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G32560 AT
Annotation by Michelle Graham. TAIR10: paramyosin-related | chr4:15713866-15716035 FORWARD LENGTH=304
SoyBase E_val: 5.00E-20 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_B9RPC9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Fidipidine, putative n=1 Tax=Ricinus communis RepID=B9RPC9_RICCO
SoyBase E_val: 2.00E-22 ISS
UniRef100_I1JUH6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUH6_SOYBN
SoyBase E_val: 3.00E-89 ISS
Expression Patterns of Glyma04g07501
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g07501
Paralog Evidence Comments
Glyma06g07615 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g07501 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g070700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g07501
Coding sequences of Glyma04g07501
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g07501.1 sequence type=CDS gene model=Glyma04g07501 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAATGTTGTGAAGCAATTATATATTCTACAAGAGAGAATCAATAAGGAGGGTGCTGATTCTGCAGCACAGAAGTTGGTTTCTTTACTGACGTCTTTGAAGGATCTTAAAAAGCAGGAAAATTACTTTCAGTCCAATCGTGATACTAAACACTCAGAACTTCAAGATGATATCAGTGAATTAGAGAGGAAAATAACAAATGACTGTGATACCGAGAACCTTCCTGATGAACTATATCATTCTTTTAGTGAATTAATTGAAAAAGTCAATTTGATGAAAAAGGAACTTGCTGCTAAACTGAGGGAAATTGTGGTATTAAGACGACAGATTGATGACCTACCGTGCCAATCAGAAGTCATCCATTTCAAGAGGCCTTTAGTAGCACTGATGGACGTATAA
Predicted protein sequences of Glyma04g07501
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g07501.1 sequence type=predicted peptide gene model=Glyma04g07501 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNVVKQLYILQERINKEGADSAAQKLVSLLTSLKDLKKQENYFQSNRDTKHSELQDDISELERKITNDCDTENLPDELYHSFSELIEKVNLMKKELAAKLREIVVLRRQIDDLPCQSEVIHFKRPLVALMDV*