Glyma04g07470 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g07470

Feature Type:	gene_model
Chromosome:	Gm04
Start:	5825578
stop:	5826117
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g07470

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_B9SQA5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Disease resistance protein RFL1, putative n=1 Tax=Ricinus communis RepID=B9SQA5_RICCO	SoyBase	E_val: 1.00E-12	ISS
UniRef100_I1KSH1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KSH1_SOYBN	SoyBase	E_val: 4.00E-20	ISS

Expression Patterns of Glyma04g07470

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g07470

Paralog	Evidence	Comments
Glyma06g07591	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g07470 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g070400	Wm82.a2.v1	IGC	As supplied by JGI
Glyma04g07465	Wm82.a1.v1.1	IGC	Correspondences based on a combination of genome sequence coordinate overlap (fjoin) and sequence similarity (ungapped blastn)

References for Glyma04g07470

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g07470

Limit To All Plant Sequences

>Glyma04g07470.1   sequence type=CDS   gene model=Glyma04g07470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGAAGATCCTTATCATCCTAAATGATCATTGGGGTGCAATCAACTTGGGTAAGATAGGAATACCATTTGGAAACGATCACAAAGGGTGTAAAATTTTGTTAGTATCTCATAATCAACAGGTGTTGTCCAACCAAATGAAAACCCAAATAGAAGTTTCTGTGTGA

Predicted protein sequences of Glyma04g07470

Limit To All Plant Sequences

>Glyma04g07470.1   sequence type=predicted peptide   gene model=Glyma04g07470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEKILIILNDHWGAINLGKIGIPFGNDHKGCKILLVSHNQQVLSNQMKTQIEVSV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain