Glyma04g07370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g07370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g07370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g07370

Feature Type:	gene_model
Chromosome:	Gm04
Start:	5711296
stop:	5714014
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g07370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G55190	AT	Annotation by Michelle Graham. TAIR10: RAN GTPase 3 \| chr5:22392285-22393957 FORWARD LENGTH=221	SoyBase	E_val: 9.00E-165	ISS
GO:0006184	GO-bp	Annotation by Michelle Graham. GO Biological Process: GTP catabolic process	SoyBase	N/A	ISS
GO:0006406	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus	SoyBase	N/A	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0006913	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0007264	GO-bp	Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0003924	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTPase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005525	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTP binding	SoyBase	N/A	ISS
KOG0096	KOG	GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily	JGI		ISS
PTHR24071	Panther	FAMILY NOT NAMED	JGI		ISS
PF00071	PFAM	Ras family	JGI		ISS
UniRef100_Q8S2Z7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GTP-binding protein n=1 Tax=Helianthus annuus RepID=Q8S2Z7_HELAN	SoyBase	E_val: 7.00E-163	ISS
UniRef100_UPI00019AA8A0	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00019AA8A0 related cluster n=1 Tax=unknown RepID=UPI00019AA8A0	SoyBase	E_val: 5.00E-165	ISS

Expression Patterns of Glyma04g07370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g07370 not represented in the dataset	Glyma04g07370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g07370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g069300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g07370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g07370

Limit To All Plant Sequences

>Glyma04g07370.1   sequence type=CDS   gene model=Glyma04g07370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTGCCCAATCAGCAAACCGTGGATTACCCTAGTTTCAAACTCGTCATCGTCGGTGACGGCGGTACAGGAAAGACAACGTTCGTGAAAAGGCATCTTACCGGTGAATTCGAGAAAAAATACGAACCGACCATTGGAGTGGAGGTTCACCCATTGGATTTCTTCACAAACTGCGGAAAGATTCGCTTCTACTGTTGGGATACTGCTGGACAAGAGAAGTTTGGTGGCCTCAGAGATGGATATTATATCCATGGGCAATGTGCGATTATAATGTTTGATGTTACTGCCCGTCTAACATACAAAAATGTCCCTACCTGGCACCGGGATCTTTGCCGGGTCTGTGAAAACATCCCAATTGTTCTTTGTGGTAACAAGGTTGATGTCAAGAACAGGCAAGTGAAGGCAAAGCAGGTTACCTTCCACAGGAAGAAGAATTTGCAGTATTATGAGATTTCAGCGAAGAGCAACTACAATTTCGAGAAGCCTTTCCTCTATTTGGCCAGGAAACTTGCAGGTGATCCTAACTTGCACTTTGTGGAATCTCCTGCATTGGCTCCACCAGAAGTTCAAATTGATTTAGCTGCACAGCAACAACACGAAGCTGAGCTTCTTGCAGCTGCTAGTCAGCCCCTTCCTGACGATGATGATGAATCTTTTGAGTAA

Predicted protein sequences of Glyma04g07370

Limit To All Plant Sequences

>Glyma04g07370.1   sequence type=predicted peptide   gene model=Glyma04g07370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLAAQQQHEAELLAAASQPLPDDDDESFE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain