SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g07170

Feature Type:gene_model
Chromosome:Gm04
Start:5571439
stop:5572676
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g07170
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G47650AT Annotation by Michelle Graham. TAIR10: DnaJ/Hsp40 cysteine-rich domain superfamily protein | chr3:17569576-17570262 FORWARD LENGTH=136 SoyBaseE_val: 3.00E-30ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
UniRef100_D7LRE2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bundle-sheath defective protein 2 family n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LRE2_ARALL SoyBaseE_val: 5.00E-29ISS
UniRef100_I1JUD4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUD4_SOYBN SoyBaseE_val: 1.00E-77ISS

Expression Patterns of Glyma04g07170
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g07170
ParalogEvidenceComments
Glyma06g07270 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g07170 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g067500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g07170
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g07170
>Glyma04g07170.2   sequence type=CDS   gene model=Glyma04g07170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTGGTAAAGAAAGTAATACAAACCCAAAGCATATTGGAGTCAATTATGTGTTTCAAGGCCCTATTGCTACCAAATATCGCTTTGTCATTGCAAAGGCTGCAAAAGGCAACCAAAACACCAACCGAAATACAAAACCGAATAGTGTGATTTGTGCTGATTGTGATGGAAATGATAATTGTCTTCTGATTTTACGAGCTGTTCTATGCTCTCAATGCAAAGGCAGTGGGGTGAACTCTGTTGATATTTTCAATGGACAGTTTAAAGCCGGTGACACGTGCTGGCTTTGCGGAGGCAGGAAGGAGATGTTATGCGGGAATTGCAATGGAACAGGCTTTGTTGGTGGCTTCTTGAGCACTTATGATCAGTAG
Predicted protein sequences of Glyma04g07170
>Glyma04g07170.2   sequence type=predicted peptide   gene model=Glyma04g07170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IGKESNTNPKHIGVNYVFQGPIATKYRFVIAKAAKGNQNTNRNTKPNSVICADCDGNDNCLLILRAVLCSQCKGSGVNSVDIFNGQFKAGDTCWLCGGRKEMLCGNCNGTGFVGGFLSTYDQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo