SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g07140

Feature Type:gene_model
Chromosome:Gm04
Start:5550533
stop:5552511
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G25390AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr5:8820637-8821741 FORWARD LENGTH=189 SoyBaseE_val: 7.00E-78ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G7JB31UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor SHINE n=1 Tax=Medicago truncatula RepID=G7JB31_MEDTR SoyBaseE_val: 1.00E-81ISS
UniRef100_UPI000233A7EBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A7EB related cluster n=1 Tax=unknown RepID=UPI000233A7EB SoyBaseE_val: 2.00E-139ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g07240 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g067200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g07140.1   sequence type=CDS   gene model=Glyma04g07140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTACAAGCAAAGAAGTTCAGAGGAGTCAGGCAACGCCAGTGGGGCTCCTGGGTGTCAGAAATTCGCCACCCTTTACTGAAGAGAAGGGTGTGGCTAGGGACATTTGAGACAGCTGAGGCAGCAGCAAGGGCATATGACCAAGCAGCCATTTTGATGAATGGTCAGAATGCAAAGACCAATTTCCCCACCTCAAAGAACCAAGCTGAAGCTGATCATGACAACAACAACACTTTCTTATCTCCAAAAGCTCTTTCAGAACTACTCAGCACAAAGCTGAGAAAGTACTGCAAAGACCCTGCTCCTTCCCTCACTTGCCTGAGGCTAGATGCTGATAATTCCCACATTGGAGTGTGGCAAAAAGGGGCAGGACCACATTCTGGCTCCAACTGGGTCATGAGGGTAGAGCTTGGAAAGAAACAAATTATAACCGAGGGTGAGTCAACGGGGTCACCCCAAAGTACTAATATTGGTGCTGTTGAAAATAATGAAGTAGAAGTAGAAGTAGAAGTAGAAGAAGAAGAAGAAGAGGATAGAGTGGCTTTGCAGATGATTGAAGAACTACTCAATTGGAACTAG

>Glyma04g07140.1   sequence type=predicted peptide   gene model=Glyma04g07140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQAKKFRGVRQRQWGSWVSEIRHPLLKRRVWLGTFETAEAAARAYDQAAILMNGQNAKTNFPTSKNQAEADHDNNNTFLSPKALSELLSTKLRKYCKDPAPSLTCLRLDADNSHIGVWQKGAGPHSGSNWVMRVELGKKQIITEGESTGSPQSTNIGAVENNEVEVEVEVEEEEEEDRVALQMIEELLNWN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo