Glyma04g07090 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g07090

Feature Type:	gene_model
Chromosome:	Gm04
Start:	5505356
stop:	5506800
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g07090

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32320	AT	Annotation by Michelle Graham. TAIR10: ascorbate peroxidase 6 \| chr4:15602777-15605234 FORWARD LENGTH=329	SoyBase	E_val: 2.00E-65	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004601	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peroxidase activity	SoyBase	N/A	ISS
GO:0016688	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-ascorbate peroxidase activity	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PF00141	PFAM	Peroxidase	JGI		ISS
UniRef100_B9RP42	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: L-ascorbate peroxidase 1, cytosolic, putative n=1 Tax=Ricinus communis RepID=B9RP42_RICCO	SoyBase	E_val: 2.00E-61	ISS
UniRef100_I1JUC6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JUC6_SOYBN	SoyBase	E_val: 1.00E-126	ISS

Expression Patterns of Glyma04g07090

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g07090

Paralog	Evidence	Comments
Glyma06g07180	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g07090 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g07090

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g07090

Limit To All Plant Sequences

>Glyma04g07090.1   sequence type=CDS   gene model=Glyma04g07090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATCTTCTCATTAAAGAAGAGGTGAGGAAGGTCTTGTCAAAGGGAAAGGCTGCTGGCGTGCTTCGATTGGTTTTCCTCGATGCCGGAACCTTTGACATCGATGACAGTACAGCAAAAGCCAATGGAATTTGGCTCTCTTGTAAAATGAAAGTAAATCAATTGTTTGAAATGGTTCTGCAACAAGCAAAGACTCAGATAGATGTTATCCAACCAAATATTCTTCTATCTGTATCTTGGGCGGACATGAATATTGCTGTGGCTGGAGCTGAAGCAGTTGAAGTATGTGGAGGTCCACCTATCCAAGTTTCACCGGGTAGATTAGATACATTGGTGCATGATCCAGAAGGGAGACTTCCTGAGGAATCTCTCAATGCTTCTGGTTTGAAGAAATGTTTCCAGAGCAAAGGCTTTTTAACACAAGAACTTGTGGCTTTGTCTGGAGCCCACACTATTGGAAGTAAAGGTTTTGGAAGCTCAATTTCTTTTGAAAATTCATATTATAAGGTTCTTTTGGAGAAGCCCTGGACGTCTTCA

Predicted protein sequences of Glyma04g07090

Limit To All Plant Sequences

>Glyma04g07090.1   sequence type=predicted peptide   gene model=Glyma04g07090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YLLIKEEVRKVLSKGKAAGVLRLVFLDAGTFDIDDSTAKANGIWLSCKMKVNQLFEMVLQQAKTQIDVIQPNILLSVSWADMNIAVAGAEAVEVCGGPPIQVSPGRLDTLVHDPEGRLPEESLNASGLKKCFQSKGFLTQELVALSGAHTIGSKGFGSSISFENSYYKVLLEKPWTSS

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain