SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g07040

Feature Type:gene_model
Chromosome:Gm04
Start:5459269
stop:5461443
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32280AT Annotation by Michelle Graham. TAIR10: indole-3-acetic acid inducible 29 | chr4:15583479-15584628 FORWARD LENGTH=251 SoyBaseE_val: 2.00E-33ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PF02309PFAM AUX/IAA family JGI ISS
UniRef100_G7JAI5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-responsive protein IAA10 n=1 Tax=Medicago truncatula RepID=G7JAI5_MEDTR SoyBaseE_val: 2.00E-82ISS
UniRef100_I1JUC1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUC1_SOYBN SoyBaseE_val: 3.00E-164ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g07130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g066300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g07040.1   sequence type=CDS   gene model=Glyma04g07040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTTGACTTAGTTCTTGCTCTCCCCACTCAAAATTCCGTTGAGGAATTCAAGCTTAACAAGTCGAAACAGATAGTGAGTTTACAGTTATGGAGAGCCAGTTGCGGTTCAGAAAGCGAAAAACGTGTCAAACACAATAAGCGCAGCTTCGAAGAGTCCTTTGGACATTTTTTGAAACCTTTGCCTTTACTAGTTTGGAGTGGACAGCCAAATGAAGAAGATGACCGCAGTGAAAAGGTGCAAAGAAACATTCACATACCAAACAAGAATGGTGATGAAGAAAACCATTTGGTGGGGTGGCCACCAGTTAAATCATGGAGGAGGAAAGAACTCCATCAGCAGCATCCTGCGAGAGGCCGAATTAGGAACGATAGGATTCAAGCTAATGAAAATCAAAGTAGAGGACCAAACTCTTTATATGTCAAGGTTAACATGGAAGGGGTAGCCATAGGAAGGAAAATCAATTTGAGGCTTTTCAATTCTTATCAGACACTCACAAGCAGCTTGATCAGCATGTTTGCTAAATACCAAAAATTTGAGGAAGTTGGAGAAAGTTACACGCTCACCTTTCAAAACGAACAAGGGGAATGGCTGCAAGTAGGACATGTTCCATGGCAATCCTTTATAGGTACTGTGCGGCGTTTAGTGATACTGAGGAATGGAAGTGAAACTATTTGA

>Glyma04g07040.1   sequence type=predicted peptide   gene model=Glyma04g07040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVDLVLALPTQNSVEEFKLNKSKQIVSLQLWRASCGSESEKRVKHNKRSFEESFGHFLKPLPLLVWSGQPNEEDDRSEKVQRNIHIPNKNGDEENHLVGWPPVKSWRRKELHQQHPARGRIRNDRIQANENQSRGPNSLYVKVNMEGVAIGRKINLRLFNSYQTLTSSLISMFAKYQKFEEVGESYTLTFQNEQGEWLQVGHVPWQSFIGTVRRLVILRNGSETI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo