Glyma04g07010 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g07010

Feature Type:	gene_model
Chromosome:	Gm04
Start:	5441201
stop:	5442438
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g07010

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32260	AT	Annotation by Michelle Graham. TAIR10: ATPase, F0 complex, subunit B/B', bacterial/chloroplast \| chr4:15573859-15574586 REVERSE LENGTH=219	SoyBase	E_val: 2.00E-72	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009595	GO-bp	Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0009697	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009814	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0015986	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0019761	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0043900	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0015078	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity	SoyBase	N/A	ISS
PF00430	PFAM	ATP synthase B/B' CF(0)	JGI		ISS
UniRef100_C6T308	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T308_SOYBN	SoyBase	E_val: 5.00E-147	ISS
UniRef100_G7JAI2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase n=2 Tax=Medicago truncatula RepID=G7JAI2_MEDTR	SoyBase	E_val: 4.00E-90	ISS

Expression Patterns of Glyma04g07010

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g07010

Paralog	Evidence	Comments
Glyma06g07115	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g07010 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g066000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g07010

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g07010

Limit To All Plant Sequences

>Glyma04g07010.1   sequence type=CDS   gene model=Glyma04g07010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAACATGATTATGGCTTCCACAAAACCTCTGGTTCCAGTCTGCACCAGTTCCCGTTCCCCCACACCAAAACTCCCCATTCTCCAAATTTCACTCCCCAAAGCCCCAACCTTGAAACTGAAACTCCCAATTTCAAAGCCCCAGATGCTGTCCCTCCTGGGAGGGATAGCACCACTGGTCTTGGCCAGACCCTCCCTAGCAGAAGAATTTGAGAAAGCAGCACTCTTTGACTTCAACCTCACCCTGCCCATAATAATGGTGGAGTTTCTGCTGCTGATGGTTGCCTTGGACAAGATATGGTTCACCCCACTTGGGAAATTCATGGACGAGAGGGACGCGGCGATCAGGGAGAAGCTGAGCAGCGTGAAGGACACGTCGGAGGAGGTGAAGCAGCTGGAGGAGAAGGCCAATGCTGTCATGGCGGCTGCTCGAGCGGAGATTGCAGCGGCGCTGAACACCATGAAGAAGGAGACGCAGGCTGAGGTGGAGCAGAAGATTGCTGAGGGGAGGAAGAAAGTCGAGGCTGAGCTGCAGGAGGCTCTGTCTAGCTTGGAGAATCAAAAGGAAGAAACCATCAAGTCCCTTGATTCCCAGATTGCAGCTCTTAGCCAGGAGATTGTTAATAAGGTTCTTCCCACTGCTTAA

Predicted protein sequences of Glyma04g07010

Limit To All Plant Sequences

>Glyma04g07010.1   sequence type=predicted peptide   gene model=Glyma04g07010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANMIMASTKPLVPVCTSSRSPTPKLPILQISLPKAPTLKLKLPISKPQMLSLLGGIAPLVLARPSLAEEFEKAALFDFNLTLPIIMVEFLLLMVALDKIWFTPLGKFMDERDAAIREKLSSVKDTSEEVKQLEEKANAVMAAARAEIAAALNTMKKETQAEVEQKIAEGRKKVEAELQEALSSLENQKEETIKSLDSQIAALSQEIVNKVLPTA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain