Report for Sequence Feature Glyma04g06990
Feature Type: gene_model
Chromosome: Gm04
Start: 5411994
stop: 5417203
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g06990
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G11160 AT
Annotation by Michelle Graham. TAIR10: adenine phosphoribosyltransferase 5 | chr5:3550774-3551986 FORWARD LENGTH=191
SoyBase E_val: 1.00E-104 ISS
GO:0006168 GO-bp
Annotation by Michelle Graham. GO Biological Process: adenine salvage
SoyBase N/A ISS
GO:0009061 GO-bp
Annotation by Michelle Graham. GO Biological Process: anaerobic respiration
SoyBase N/A ISS
GO:0009116 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process
SoyBase N/A ISS
GO:0009117 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0003999 GO-mf
Annotation by Michelle Graham. GO Molecular Function: adenine phosphoribosyltransferase activity
SoyBase N/A ISS
KOG1712
KOG
Adenine phosphoribosyl transferases
JGI ISS
PTHR11776 Panther
PHOSPHORIBOSYLTRANSFERASE
JGI ISS
PF00156 PFAM
Phosphoribosyl transferase domain
JGI ISS
UniRef100_C6SXZ1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXZ1_SOYBN
SoyBase E_val: 2.00E-140 ISS
UniRef100_G7JAH8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Adenine phosphoribosyltransferase n=1 Tax=Medicago truncatula RepID=G7JAH8_MEDTR
SoyBase E_val: 8.00E-118 ISS
Expression Patterns of Glyma04g06990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g06990
Paralog Evidence Comments
Glyma06g07090 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g06990 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g065800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g06990
Coding sequences of Glyma04g06990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g06990.1 sequence type=CDS gene model=Glyma04g06990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTCGCCGAAGAGAATGGCCTCAAGGGAGACCCCAGACTCCAAGCCATTTCCCAAGCCATCAGAGTCGTCCCTCACTTCCCCAAACATGGAATAATGTTCCAAGACATAACGACATTGCTGTTGGATCACAAGGCGTTTAAAGACACCGTCGACATTTTTGTCGATCGTTACAGAGACATGCACATTTCCGTAGTTGCTGGAATTGAGGCAAGGGGGTTCATGTTTGGTCCCTCAATTGCGTTGGGCATTGGTGCAAAGTTTGTTCCTTTACGCAAACCACGGAAGCTGCCAGGTGAAGTAATTTCAGAAAAATATGCTCTAGAATATGGAACTGATTGCTTGGAGTTGCATGTTGGTGCTGCCCAGCCCGGTGAACGGGCCATAATAATTGATGACTTGGTGGCCACAGGTGGAACTCTGTCAGCAGGAGTAAAACTTCTAGAACGTGTTGGGGCTGAAGTGGTGGAATGTGCTTGTGTCATTGGTGTGCCTGATGTCAAGGGGCAGTGCAGGAGTATTGGAAAGCCACTTTATGTTCTTGTTGAGCCACGTAAAGCAGATAAATGTCAAGCTCAAGCAGATAAATGTTACTGA
Predicted protein sequences of Glyma04g06990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g06990.1 sequence type=predicted peptide gene model=Glyma04g06990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MFAEENGLKGDPRLQAISQAIRVVPHFPKHGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMHISVVAGIEARGFMFGPSIALGIGAKFVPLRKPRKLPGEVISEKYALEYGTDCLELHVGAAQPGERAIIIDDLVATGGTLSAGVKLLERVGAEVVECACVIGVPDVKGQCRSIGKPLYVLVEPRKADKCQAQADKCY*